ELF`c@4GP4 (44@4@  TT@T@ @@HHHԟdd@d@PtdGGRtdHH44e(/lib/ld.so.1sX b@ Fl@=@@ # p<0I@0Ippp@ ppp$po@b@oo4]@ YBQrEhAnU>- FSPE !X7RG/iNHK j~I V8w]&?\;13Z5Upb:(7slSA]kn0Vmt_}+qx LIGoyt_\{bK;Ws^W:=4d,"x,}e${ajJV/[q-u<18HL~26 $ p+''i)<0>!MZ7gYq#T3lO[RA|2@@ m4hQ)<PDwEQ+*vX0X#C"% oaP5aUC`.:D(&O9Kt w^czgsfW96L eT_mo|`u|({?Fg=rM^u3fIOzb`'/ H B ~"J*DT$[ \;&c%z6 .8-N4yvSydx=n%kBJ#5) ,hf]9 d?vrNk12>*G.c!CMeiZF@ljYRp}X:I~F @0IbF 0IIX:Ir!`c@ I<0IqX:I C eAh %{Ah SC, L!CH B@ b@.LB< FpFPD< 4C (C `F Dl |:IPFl@FE 0FDT  F|FFFwYB` hC F&F:FF Cd C| B 8D F+FdF8@ G pFt`FV ̗@ PF1@F0FRB  bA (A HB (D  Z F+ A4 ܧD\ RAd C PsCh xCl F< F d%D }8D F^ TA  NF`D  D hB8 eB  /B( FaF]B FxE Fp@  iFFILeAx uB 'pF`FsPF@F0F`h{C P}@ t FpE lF! F0_A  FO F3&C, oA v,0I Fp PE  * FFlC hBC| ,@D $D@ ((D  F FR FВA  Fp Fxp@d c\D@ :I8 EL C4 DP ` FP F4Cd d@ FDBT 0 Fx:I@{@ ~lB  cAt lE # z Fwpe@ E C| pC@ S C $Ch A  Fh_C C| 0 F45A k'A ( FTB` % F\AP  F;C` B  F Fv Fk F F E B n4EC p FE\ Qf@  B ` F P F ȪB  @ F40 FL F pC|  F n@ g F0dA ^ D@  F_:I F F FZA `cB<  FC "A RC( yTBT ,aA  F F:I:I Fkp FCЃ@ X.A ` FjP F7 @ F0 FabB  Fn Fv F^KA`  ( F:@t XF FC ~`:I-9A xaC FFF0,B %D Fv@8 \:IC8 F pF xC `F4C PF,@ @FO0F F d:I7H1A CCP C {FZAx -FCP xjB` `IFA * F g@ z|B HC  4C B\ !F(e@H F8gB0 wI$)DL F:C  s|h@ iF7FpF 2C  5B pFUC  `FPFZ@F4D P CH @B E 0F} F*A bF t@ 8A { Cx PE :F],C  <FF$D( mBt FFF<4iIF EH JC LHDD eB FG 4A C FF8D ixfA \rB B ? pF7`FPF0@F0F:D<  F;F=FFQF0E gA U@ F1([B {F`E +FO @X $XA0 FCh %:I!pE< xB F DH B 3"FBX : pF C |,G  `FmPFtD (@F0FspzC ԕA  C yLB  FFCFo A p)DD ID A 2C  MBx lXAl $(C F7FCT FFA F/4D\ nA F=D t FFpFC0 ( @C B `FPF@FE +E @ D  ĆA  CD< 0FB  A Fk FBFXFF?E8 kB &F)FF 5Cd c E 2F m@ |`A E FHwA F/Cx X:I C |pF] `FaA  C PFE @Ft&A l=A` 4ZA TC B 8 l%C w0F7 FrF`E F__libc_csu_init__libc_csu_fini__libc_start_main__gmon_start___Jv_RegisterClasseshash_table_gethash_table_remove__errno_locationrpl_strerrorxmallochash_table_newhash_table_putdcgettextlogprintfexitselect__fixdfsi__floatsidf__subdf3__muldf3__eqdf2__nedf2recvmemsetgetsocknamegetpeernameabortmemcpyacceptsocketsetsockoptbindlistenprint_addressstrcmpescnonprint_urilookup_hostquoteexec_nameaddress_list_address_ataddress_list_releaserun_with_timeoutaddress_list_get_boundsaddress_list_set_faultyaddress_list_set_connectedaddress_list_connected_pmake_string_hash_tablexstrduphash_table_destroydl_url_file_mapdownloaded_html_setstring_set_freehash_table_iteratehash_table_iter_nextdownloaded_css_setstring_set_addhash_table_get_pairhash_table_for_eachhash_table_containsstrlenstrcpystring_set_containsrenamestrpbrk_IO_putcfputsfwritenumdigithash_table_countstring_set_to_arrayget_urls_htmlget_urls_css_fileurl_parsedummy_iriurl_freewget_read_filelogputsunlinkfopen64wget_read_file_freexstrndupstrrchruri_mergefclosefree_urlposptimer_newptimer_measureprint_decimalptimer_destroydatetime_strferrorfputcgetlinexcallocstrdupdelimmemcmprpl_memchrsscanf__ltdf2strncmpstrchrqsortextract_paramc_strncasecmphttp_atotm__adddf3quotearg_stylematch_tailmake_nocase_string_hash_tablessl_connect_wgetftp_authfd_closessl_check_certificateftp_greetingnumber_to_static_stringhuman_readablesearch_netrcssl_initscheme_disableconnect_to_hostretryable_socket_connect_errorconcat_stringsftp_loginftp_pbszftp_protftp_systftp_pwdftp_process_typeftp_typeftp_cwdftp_sizesocket_ip_addressftp_pasvftp_epsvftp_lpsvconnect_to_ipftp_portftp_eprtftp_lprtftp_restftp_retrftp_listoutput_streamaccept_connectionmkalldirsrotate_backupsfopen_exclfile_exists_pfd_read_bodyretr_ratetotal_download_timeset_file_metadatafd_errstrftp_responsestrtollurl_file_nameremove_linksleep_between_retrievalswarc_tempfileurl_stringprintwhatdownloaded_filewarc_write_resource_recordtotal_downloaded_bytesnumurlsinput_file_urlfile_mergeftp_parse_lsacceptablestrstrposix_fnmatchfnmatch_nocaseaccdirurl_set_dirurl_set_filelstat64readlinksymlinkset_local_filechmodtouchftp_indexhas_wildcards_pyytextyylengstderrstdinstdout_IO_getcclearerrfread__ctype_b_locyy_scan_bytesyylexappend_urlyy_delete_bufferfd_read_linefd_writestrtokc_strcasecmpbind_localskey_responseurl_escapehtml_quote_stringlocaltimeurl_escape_unsafe_and_reservedfflushrpl_mktimefgetcatoichar_propstrcatstrncatstrptime__divdf3getaddrinfoinet_ntopgai_strerrorfreeaddrinfostable_sortxstrdup_loweris_valid_ip_addressfilenoflockfseekftruncate64fopen_statfstat64xreallocrewrite_shorthand_urlurl_errorinform_exit_statusmap_html_tagsget_urls_cssurl_has_schemestrcspnstrspncookie_jar_savesetlocalerpl_timegmwget_base64_encodestrtolfd_readwarc_write_response_recordmemrchrmd5_init_ctxmd5_process_bytesmd5_finish_ctxrandom_numberurl_full_pathntlm_inputntlm_outputgmtimeaprintfversion_stringscheme_default_portfile_sizecookie_headeraddress_list_containstest_socket_openmemmovefd_read_hunkftello64feofwarc_timestampwarc_uuid_strwarc_write_request_recordcookie_handle_set_cookieurl_unescapeunique_namehsts_storehsts_store_entryfdopensocket_familycookie_jar_newcookie_jar_loadhas_html_suffix_pnonexisting_urlwarc_closelog_closefree_vecvec_append__fixdfdivalid_progress_implementation_psepstringmerge_vecsgetuidgetpwuidunique_createisattytcgetpgrpvfprintfvsnprintfcompiled_featureswgetrc_env_file_namewgetrc_user_file_namecompilation_stringlink_stringhome_dirpipeposix_spawn_file_actions_initposix_spawn_file_actions_adddup2posix_spawnpxmemdup0program_namebindtextdomainbase_nameprogram_argstringdefaultsrpl_getopt_longrpl_optargrun_wgetrcinitializerpl_opterrrpl_optindsetoptvalrun_commandcompile_posix_regexmatch_posix_regexgnu_getpassfork_to_backgroundset_progress_implementationlog_initwarc_initperroroutput_stream_regularsignalprogress_handle_sigwinchhsts_store_openscheme_leading_stringurl_schemeurl_uses_proxyretrieve_treeretrieve_urlretrieve_from_fileprint_broken_linkssave_cookieshsts_store_has_changedhsts_store_savehsts_store_closecleanupconvert_all_linksget_exit_statusredirect_outputprogress_schedule_redirect__gedf2iswcntrlwcwidthis_basic_tablerpl_mbrtowcmbsinitmbtowc__floatdidf__gtdf2calc_ratelog_set_save_contextdetermine_screen_width__divdi3__moddi3log_set_flushclock_gettimesysconfclock_getresschemes_are_similar_paccept_domainsubdir_paccept_urlres_get_specsres_retrieve_fileres_parse_from_fileres_parseres_register_specsres_match_pathregister_delete_fileare_urls_equalnumber_to_stringsufmatch__ledf2random_floatxsleephsts_matchhttp_loopftp_loopregister_downloadregister_redirectionregister_htmlregister_cssurl_valid_schemeget_urls_fileptimer_resolutionconvert_to_bitsfd_peekinflateInit2_progress_createprogress_interactive_pptimer_readinflateprogress_updateprogress_finishinflateEnddcngettextis_robots_txt_urliconv_opennl_langinfoiconviconv_closeget_max_lengthfile_non_directory_pmake_directoryis_valid_ipv6_addressgzwritesha1_init_ctxsha1_process_blocksha1_process_bytessha1_finish_ctxbase32_encoderewindfseeko64gzclosepath_searchmkostemp64strftimegzdopenstrtok_rbase32_decode_alloc_ctxlog_set_warc_log_fpsha1_streamfsetxattrrpl_regexecrpl_regerrorrpl_regcomp__fixunsdfsiusleep__sigsetjmpsetitimersiglongjmpgetpidsrandomrpl_ioctllocaleconvpathconfsha256_buffergroup_membermkdirutimeforksetsidfreopen64vasprintfxmemdupfd_transport_contextSSL_get_peer_certificateSSL_get_verify_resultX509_get_issuer_nameBIO_s_memBIO_newX509_NAME_print_exBIO_number_writtenBIO_readBIO_freequotearg_n_stylequote_nX509_verify_cert_error_stringX509_get_ext_d2ia2i_IPADDRESSsk_numASN1_STRING_cmpASN1_STRING_to_UTF8ASN1_STRING_lengthCRYPTO_freesk_valuesk_pop_freeGENERAL_NAME_freeASN1_OCTET_STRING_freeX509_get_subject_nameX509_NAME_get_text_by_NIDX509_NAME_get_index_by_NIDX509_NAME_get_entryX509_NAME_ENTRY_get_datai2d_X509_PUBKEYCRYPTO_mallocwg_pin_peer_pubkeyX509_freeSSL_shutdownSSL_freeERR_get_errorERR_error_stringSSL_newSSL_ctrlSSL_set_sessionSSL_set_fdSSL_set_connect_stateSSL_stateSSL_get_sessionfd_register_transportSSL_pendingselect_fdSSL_peekSSL_get_errorSSL_writeSSL_readSSL_connectOPENSSL_configRAND_statusRAND_file_nameRAND_load_fileRAND_egdOPENSSL_load_builtin_modulesCONF_modules_load_fileSSL_library_initSSL_load_error_stringsOPENSSL_add_all_algorithms_noconfSSLv3_client_methodSSLv23_client_methodTLSv1_client_methodTLSv1_1_client_methodTLSv1_2_client_methodSSL_CTX_newSSL_CTX_ctrlSSL_CTX_set_cipher_listSSL_CTX_set_default_verify_pathsSSL_CTX_load_verify_locationsSSL_CTX_get_cert_storeX509_LOOKUP_fileX509_STORE_add_lookupX509_load_crl_fileX509_STORE_set_flagsSSL_CTX_set_verifySSL_CTX_use_certificate_fileSSL_CTX_use_PrivateKey_fileSSL_CTX_freeDES_set_odd_parityDES_set_keyDES_ecb_encryptMD4_InitMD4_UpdateMD4_Finalwget_base64_decodefread_unlockedfeof_unlockedferror_unlockedlast_componentbase_lenlocale_charset__ctype_get_mb_cur_maxiswprintxalloc_dieexit_failurewcslenwmempcpywcscattowlowerwmemchriswctype__ctype_tolower_locmbsrtowcs_getopt_internal_rrpl_getopt_internal__fsetlockingtcgetattrtcsetattrfputs_unlockedfflush_unlockedputc_unlockedhard_localetzsetlocaltime_rrpl_re_syntax_optionsiswalnum__ctype_toupper_loctowupperwcrtombtouppertolower__secure_getenvgmtime_rmktime_internalgetc_unlockedungetcfscanflibrt.so.1_DYNAMIC_LINKING__RLD_MAPlibssl.so.1.0.0_GLOBAL_OFFSET_TABLE_libcrypto.so.1.0.0libz.so.1__fixunsdfdi__floatunsidf__clz_tab__thenan_df__lshrdi3__ashldi3__ucmpdi2__unpack_d__pack_d__fpcmp_parts_d__clzsi2libc.so.6_IO_stdin_used__environ__xstat64__fxstat64__lxstat64_ftext_fdata_gp_edata__bss_start_fbss_end/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/libGLIBC_2.2GLIBC_2.3GLIBC_2.7GLIBC_2.0s ii Xii  ii  ii ii  $"$J $ IP$ E8H$$GT e$$$€@ $!0@!@ $&$#$3$2$;$"$q$u$o$t$&$a$m$p $< $l $g $)> $UPeQPeGPg LPITbonm!@<B8 bevhdc$yxhdc$tsrdc$c$&@`4!0,($ 8'J<'0',($ $!! I<:9 5@4B:@I<8 ! :I<:D !(`@!@"B @I<$B$ B$ B I䀙 ! $Cp܏B$#'H!(!#$%$2 $3$%$5$; $B $? $F $ pPOfPF mPFkTC INIG B$GLQCFGJB$$` @䀙 !T !$܏ ('J<'0'40,($ "$!!!B!'$BR&!"$&1&$! @ !(`!  !(`!!#$ &$ED$&`!&+@T! $#00 !8`! @ !(`0&4 4!0,($ 8''J<00'!4,($ Hя!!! /! !܏! @ !@!PB$܏#'F$@\C C$$0 '!  $#V(F<$$ ! ܆$!@ $!@ ($ D4!( !0@!8 $S- cUT$! u- !(@!@!0  \C􃂏 C  '!  $@! u- !(@!@$V T! g= !8$!@$(F<$$ ! $ !@!(4!0@ !  TB4! !8!0r8 !@S- dC`E% @Č*d@T+$LŒ+@!`+$L!`HD@<840,(P''J<80'!<40,($ !Dů!!!o/$dÎ% @P"*dj@T"+d@"$]CT$1  d܏$ !@!&@܏&#' f€@H< WF<€@TH<'! @$'! @ $ ܏x ! @@܏(F<($$ ! ܏! @ !@܏!(4!0@ ! ܏$$C d ܏! `!(@ !@Dŏ!0$; ! `܏! ` !(܏l ! ܏$1 V`ŎdC`E% @$Č*d@+$$Œ+@P$+$!<840,($ @''J<0'!I <;* HC%$!!Ư!;#*@$;*c$d$bc0b`4$$bdb4Ac4$$bb ҏ$!dC`E%@Č*d@TI< T$bŒ+@P$bI<;b+$$b$ ¯܏E,!  ¯܏!  !(܏! @$dlBW@$BU@TC ('N@܏d`Џdяpŏ$$BP$ BQP$c0B*@((`F@B&"B$ E#B$/@#!cB@!B B0@c$$!c!DB@!B B0@c$!dC'$b"$bT$"B$$쁙! d,($  0',!($ 0'J<'0'D@<840,($ !t! ! !(!@!$'\'$:CHb !"$C $CPdLTTbd!5TD!(RE !0!@ b$$$ e! @$ !@!@)!  !8@@!@B0B4TTbcD!5!(!0RE @!@! @ !8@@!@B0B4bl ! b!"H @ ! D@<840,($ H'J<'0'<840! !@!@  DG<4!8@w$!0@ $!CP&'!( $(E , ! ,<840@'J<'0'!Gb0c0<P'G< R$! $ GO !(@ 0GO !(@(B(@ HO @!@  !PBR$ GO !(@@!@ $b !(@!@E$R$ ! !@ B,%@L!  -$ @t!( ! !  !(L!  :$@ ! $h!(#0b ! *L!  [$#@L!  ($@! !0!(C,$ bD$bP4 ~P4 rWc84 C ! $4$*@!`! !(@!@x ! t G<O !(@@!@!  l  !  $G2V0'(G<$V$ ! $܆!( !@!(4!0@ ! l ! 0'!(  $b@Pb$@P4 $4@0B400'0!B4!00'$' (A<$8 ! !(,f$ '@ $$C, @!@!(F<$! $!@$!  D !!( 4!0@ ! !$ $bEP&DTc&c`Tb*! $ $$ r !@$pcb!@ $$B UP5$&& $"TTRB4B"1&R@VBD `(G$;B8B,! $+@P!80b(@T:b(@T!8Ab( @T[b(@T!8b$+b@P!8t$b!8+@<$;B8B,! $+ @$À0b( @T:b(@Ab(@T[b(@b$+b@m$ b$ L+@P! €;B8B,!0! &$+O@P!80b(@T:b(H@T!8Ab( @T[b(B@T!8b$+b>@P!8;LT!88M!8€6PT+@'$;B8B,! +)@P!80b(@T:b("@T!8Ab( @T[b(@T!8b$+b@P!8u$bT!8MT!8t$ b!8+@"$;B8B,! F!(!8$ BN $CTBRB$$J%+@Tbd#BbC$!*#@T@7$V bMb#T! U!`*$@T@#Rb b@ ؀d !( b ! ef! @ !@$p bqbd!0@! D !(bc!BbF$!`*&@T@#Rb b@ ؀d !( b ! ef! @ !@$p bqbcD$!b2`@db$!U 0fc$f$+ $D|!8D@<840,($ H'J<'0'$ !%`!l !  Œ$@ !  ('P Œ Œ@T@l Ќ!0l! $ (''J<(0'!,$ !!$#&#'!0 ! ܏!0! @ !( ܏+!,($ 0'J<'0'|xtplhd`\X!@!'C0$$ 0C$0 $X' '8'L4$,!@<8HP! ,! @(<$ #0@R$+V@!$b/$0:@$+V7@-$D41D$(-$ D>$&YTc$b#DTc$b DTc$b$b DTc$c$vbD>$FTc$ b$+v@bD>$ YTc$bETc$b$ B-$c$+v@TbV!$R&!H@! $-$= $<$/ $ $ $" $' $pV$ ,@G$yTb$9!B0^B,5@$4k$0h>$0b$,j!`$5!gTb$!-$/$B0^B,)@P!`'kP!`$h>$#f!`jTB !B $R&dTB!` $B!R&$gT! B!R& $gTB$!R&B!R& $g$B!R&! 2V,,bD49'+6@D$4D=$<$/$+6@,#b$B0^B, @PDfPDe>$yDdT1&D ""C$b0B,@P4$<d4$E@P41&+6@T",T# $!@@` `C b` `D`yb>$d<$b,Da $@0HD$H_ 0!!$$b0B,@/$$<f97$Y@/$1&+6@T$Q,T"1&+6K@,#d$0B, @<$$<4$F@T1&<$y>$b,"<$C>$D! +.@,b$B0^B, @=$e<$f>$y/$bT&5!d$0B,@b$$<4$F@b$&+@T ,B0^B,@P/$=$gy$=$bb<$`d>$^e=$^f&+@,%b0B, @"$$y<c4$C@"$$'$,! $+@!0!`<$ $ DT$!0 $ Y>$ D$+@,€H$+H$)!+@!L,!($$+@,e$0B,@P<$$<97$Y@<$bT$ !$!,!($$! ,! ($03T!!( a !0,@& @ *y@T@@b<`$(br؀ 88 br $ <@$0dp8! @ 88H@$r(!( !0H_ $(,$HH_ !((#~ @ 4 0`DbE"&b0D2&4 <8@8 !0!C $!D$*@ 842&DHLPTD ##DbV D !0`@ V P@PT!0'Ta 'P #<$hb+Vg@,,@0l  0( 4,$<@l 8'Ta '>e>$>!$$F!  $!!`!$! `!@|xtplhd`\X'J<'0'TPLHD@<840 X@!@ ! DG<4Xw$!8@ $TPB!!<^4 '!$~(!  $ #0C$! b! +@T !(B$WB0B,@$~`!($+ @$B$WB0B,@$~`T!(V䄙 d !@, !(@! l !@4 ! @l!  !@(! !0 !8#@!@ ! G<(! X$$ !@X4!(@!8 $ l ! l !  $l ! $  $@P!@!@!@!+@, ! `T!@PLHD@<840X'J<'0'\XTPLHD !! ! @!@  D G<4!8@w$!0@ $ !B<(,PI<|;"04d@8 $|;"I<P$ I!!><I4$$HB0B,@$i`$<J4 $=$$IB0B, $j@`TT$E<I4$$HB0B,@$i`$P` =$``$&GB,!(rpT!<$I4$$HB0B,@$i`"$$"$!Te$b"$CU`E$fT!lbB$FB0B,@$h`P$@G$"P$@PƏÏ$;b$ŏ$SDj $@܏LD!@Ə`Œ*CH@ɏ$(X"@T\"=U(G$.b@b@lb @$b @b@pb@0@/B@ŏ|LD !(@@܏Ï܄ Ld A@܏ď/$ L@܏D>ŏFSI<[B@!I<[P S$ "$"$" BBb&@,b@!,B@ ! !( ! I<[B@I< ! I@@T@+<@D@ĈB!cCc0`PDX\`#0 !8$CXX\$DT@\#C X@PXT\ ! @DP ($ $@$Q!'J<'0'<840,($ !!@!'$$ !BT! #"' c!B!(@!0 @! <!840,($@'J<'0'd`\XTPLHD@ 0 !Hi %)! @B+#!(x!(e8pt40\ 4 0掤$4#r!@d$ !(+*P ` G$ &!^#!0!   $!0]$ &*'@b@'*b@f$@B$#0C[$¢&!($$ $> $= $< $ijTlk$*! `@c$]$$88B$4$$ 8! @\ !@ $#!0!   $ !G<_$!0  !   ! @!(`!0!8 !T@ ㎔%dP@!q!掜pt+#( ! ! @d!(`!0@ !8` ('!(!0@!  !8` !@H<(F,G! !(` !` A!0H<0F4G!  !( B($$ 0bB@(I<B$I<B$!bcH< $ !  !H<$!   $ &0@(  V4R4! @H< 8FA H1!P 0(;@!:( @TA(5@G(@T$+/@0()@%:( @A(A($@T!P G(@A($+@T!P A(@$F0+$ 0b$F0A(@P$$+$ 8b$B0!FVV P!P !?!f0(;@!:( @TgA(5@!G(@Tg$+.@!g0()@i%:( @A(A($@!G(@A($+@!A(@$F0+$ 0b$F0A(@P$$+$ 8b$B0!FP!!H`B'w+% "!`%$/$$$*h@T$ '%J<'0'$ !! d"!R@"$*!&@l  l! $  ('J<'0'$ ,H<\å$ !! !(@ !@! l !@$! ('J<'0'TPLHD@<(,!H<< \å$(H<($hå$! @!@l H(!(@ ! (Hl`! 0'!0@ $(@!@ 0 ! (H<4Lĥ$$!0 !8@ !@(! l $(! @!( !0`!8  (!  !@(+l+ Hbld ! $(dl (`T:B,PLHD@<X''J<00'!4,($ ! !܏ß! !(` !@!PB$܏#'!0!(@ ! ܏&:$!! !0  !8`J<ȊD܏! !(܏!40,($ 8''J<80'!<40,($ !! !܏ß! !(` !@!PB$܏#'!0!(@ ! ܏&!:$! !0 !8` J<Ȋ@܏ ! ܏ȊJ< Ȋ!(' ' @܏ďJ< ܏J<ȊD ŏ!  Ȋ܏! !(@ !0!<܏480,($ @'J<'0',($ +!0@@/B8B,!(䄙! !(c$* !@ $@؀ ($#C$(Cp,!QRS$( 0'J<'0'LHD@<840,( !! $ $!@ !!!$!,!  $ #0C$! b+@<B$^B04B,@$d`+&+@! #$F!( PbT!0H<å$ $6@4Rs&&8!(!0 ,! @f *s& .`E!!B!DB+!*e @c$  !@H!( !! @$!8"*h0D@c$l QP PB* @L؀D (CBCL!@HD@<840,(P'-$'fP&9!0!!J<'0'$  !@!@(H<å$$ ! !@ ! D!(4!0@!8@ $ $D E!  !@$!  ('J<0'C`LB@J<'0'  @I<4b@$4`! 'J<0'l ! J<'0'bE@!d =@ $$$4T!P!VH<@Ä$PVH<@Ä$PVH<@Ä$P VH<@Ä$ @!@ @!4 ! @䀙!   '! 'J<'0' !B ! @l +! ''J<0'! !܏!@pd& /!b&܏#'! #  '܏@'84B0WCT!pQG<@%$G(@T$$+b6@%$0(2@%$:( @A(A(,@%$G(@A($$+b$@%$A(@$F0$+b$ 0b$F0A(@P$$$+b$ b$B0!FH<B0c$!Ccc0`$%$$$'<840,($!!''$!(! @!("@P ! !(@!@  @!@@$D$+c+ d $ G$ ( P!@! "D,<!840,($@'J<'0'$ !! P$$ B$!P$ B$!P$! ('J<'0'40,($ !!!% &+!"@! ' !@#  @$ ! !@G<R&wT$!`%$% #2!c0! !t@&b&!R&Q D&4!`0,($ 8'J<'0'$ !! ! /$$&#!(!0@ !P  ! ;$$&#!(!0@ !P ! ?$#$&!($ !0@ ('$ ('J<'0'$ G !D$ !@!@!! @ !(@ $! ('J<'0'9!l l l l l l (l ,l ( l ,$l  $l!   ' 'J<'0'$ H J< B @(H ܏ ! @!<J<܏ B840,($ @'!!!@H<τ$!(@!0`!8!!!@H<τ$!(@!0`!8J<'0'|xtplhd(J<Bi@b@@0'b@ $0' ! (J< $H 0!  ' ! 0J<$!0!8 0@ | xH 0 ! J< BT@0BQ@J<8'!( $ 0<=>?@ABCDE`Fb@H<\S$H<@H<\R$ ! 0!@'x| ! J  ! 4J< B0,($ 8'J<'0',($ !!@! $$ !  !@! !(@!0  !8@C( $,($ 0'J<'0'$ !!D H<4ф$!(@r !0@ D ! H 4 ! @H<ՆՇ!(` ! @!0@! 'J<'0'$4b@$ cb!$ D@.fV^F$N >f V ^ .FLh@$`'H$0?(%8&0@)! %E! @! &0Z<$0_yB4%Xc!(@&0%C!(D&pZ&0@9! n<%x%G! 7! !>&0&r&0@9&T!p&W%G!f!b@&Q(—n<%%&34&"!(@9&0&X&0%G!(@G &Xvn<%Q%@&Xy!(4!(! G&0@ _ %+&0@9! n <%x%G! k5! !0+&&P&e@9&PU!0&P^%G&`!0!0_@ (W &`n<% %Xe&`B4!(&o@8 |&d!(|@9W g !(n<%@ %PD%G&h-c4!(& K!&h&h& @9!O|%gG@x 0o !Dn<%x%@&p4!C!0&p& & @9!0%g!0!0&p|&Hig@X(w&H9n<%`%Xn&H#4!(d@h & O &%h& @9!(W&n <%PB%g&!()5x!(!8&L@X§&F@%Xt!8&t% !8!8tO<0%H&x&ܼ4!0d@A%&r&&b% _!0$($j%e!0!0%Xb@@<Ÿ%@%&ܼc4p$I&!@$%C&@!@ &W8%PG% t!@@(&·!(\$ & $J!8&0%C!8@&% !8@!8%"pO@%H(`!07@A&&%% &^!0&B_$l$(!0|X%Xb%e@l—%2%\&!0!@7$$I&%%C&*@!@ &% !@W@8$K&@%Cdh!(@&!(@`%`% <&^!(&@wOܼB40%H&&x!0@AW&%PB% !0%`@@!0% %@$8$$m$ <%g% d\&pnܼ7!0&p!&xG&p@9!m%G_@h(w!db<%h!b%Xe7X`! &(j&G&p&(@9! &x%G! ! @p\%p&(O0%H&&@9!(&"&0+%G&8&&0!(XW@x‡!(b<%x%PC&84@%!(!&0I&0@9!k%G!f&0!b&b<@8_B4 T%Xd! &0jT&0! O(%H%%^T@9&%! &1Tb<&/4! !(@&0+&%&0@9!(W& b<%PC%G&!(97!(&0I@!P&0@9!k%G!f!bPT&_ &b<%Xd%8&4! &@8&0j&L&0@9! &L%G! &! P@O¿(b&8%(O!F!E%H#@Pb<%&`4&0+&`!&0@9&`!j.%(W@ g !fb@`!@ 'J<'0'40,($ Ռ!!$!$#U+E!@ $!(`!  !0@Ž!(BA,@Ů$$(! \  !0Ǝ!(U?0$(! Ʈ !(#2!r@".%@b2@ &!`!  ! @@$\  !0A.!(@! @$@R&@&"&$(Cp!! !d$$(%! `!0\  !e?12 4Ď &!$!(`! D !0 @. @! @@$\  !0&! @`& !0Ю40,($ 8'J<'0',($ !!.D0%e"%dB0'%b! @!(  $.D0%e"%dB0%bD&!(  $.D0%e"%dB0%bD&!(  $ .D0%e"%dB0%b D&!(  $.D0%e"%dB0%b!( D& $,!@($ 0'J<'0',($ !!C8D- $$+0j D!#"B$"$"B%b.&F0N>h0%(2B%8D&I&%(?<%8c0B0 H 4!H)%8%(! $!0F 0&0%H$`B6- %0%(&`!h&h&D$H*$ p&f&E!h%H$!h!H"!H- B# !h% V9<@ * [s6!@S%(  &7 %b %&%`+  $5 &(B %b%0$+&N!@& $`&(& !@%`!@!`!`$ !@ / B;  @%E2%8%0&8%b%P&0Y &ho@ %8%p$ &(&0$@$&0$h% %BT %PP&h!Xi@N!8&(%i:!Xm& %P!Xe& !(&&C!!(!Xq&C!@E > 2 Q %PGB+ %0 $<% %(M̡5%H2!@B<@&(&p %8Bn %q%%h$pn!@@~&g!:<&p% &0$$P%Q&0&(!@!H% &g&D !@!#!&D!!b!@>Q @M%PG% 2B+- <%0%(Mo,5&xl@%H4!hM &(B< %%8$xBv%q%p&x@!h&0$P$W&g!:@&0&(% !h%J%S!h!E&g!(&D !M!&D!bB3(!h%(%0U@M & %PT: $q B~ &0$%p@%x%8B$% &8%s@vtJ <)& %(&d%S")5%P!H)$&d&E D&+!H,$$`P&8&0!H1%! !H'!#!&D!!b!H7@U : %8\ <(ܩJ5%(%B3!P(& q %0e!PK$$X&%p%`B$@&0% % &0$1$B~ &8%s@v)%x&(%(&d%S" &8!PQ&d&E !(!PG!!&D!!b(!PV%(@] & : q B3%p%8%0B$@v <% %vڈk5%!X&de,!Xh$r$@&-%`&0%h &0$QB~ &8@v)%x&-%("%V&8!Xq&d&E !(,!Xg!!f&D!k!b!Xp(%(A  %@@% : B3%8%0B$@% %v> <0%t&dRQ5!`&8$5$@t!`&0@n)%(%(&I"%V &d$p B~ u&E!(%x%p& !(&D&8&0!!`!`!&!,1 < mƭ5!`% %3BC!hB|42%x%@$3@,$T%&@%(!  B6 %B &pj%0%C: @ $$p%8% &p@!h&8I&8&@%H6!h&(!>!h&(!H& !M!&  % q lB+ @E %p2 %(.h<$P%0o5E@%@!xoP&(B<P& %%8BN %v%H8p$!x&0$P@v$&g!: &+&(% %%V&0!x!&g!(&D !x!&D!!b( !x% t <(@E>2qB+J5%p$%0%(!PJE$d%%@BN&(@%H8&($!PK&0$X$4B<%8@v&0%vP!%+&% &g%V:$!%&g!(+&D &L!&D!b!PR!PF,!*`!PS,x <&@E > 2 q B+ oc)5L%p% (%0%(!H$SB^ E%Xx%@&mL!H,&0&(L%5@&0(B<!H3$`5%8@v!H&%v$P!&(% %L&g%V:!E&g!(&D !I!!H4&D!b@E > 2 q 0%pB+0 %0Ȅ<% ,,%(]x5\ %Q%Xw!@Bf &(&O%`&(,@B<!@ $hQ&0$%8@v&0$3L%v!%&o% &g%V: !@!&g!(&D !@!&D!!b!@H@]2B+ >% H00i%0%(]nj<&*%h%XwBf&(5%`&(!pn0%$B<@&0%8$h& &0!p@~%v$q!% !p%m&g%V: !p!e&g!(&D !n!!p&D 2aB+ 5%`% %tHH%0%($B~]!h%x%Xw&X!h&0$Pt&($X&0&(HB<@!h% %8@f!h%v!! ! % !h&g%V:&g!%&D@U > 2 y &D%x!#%0P %x& &M8IxB4%H'$@%t$x9!$B%'%x!N&i&M&q!R! !C! !u8!!b @B$8H!h!! !!N!X48<@D +@!8,($  0'J<'0'40,($ (Ռ!!$!$#U+E!@ ,$!(`!  !0@(Ž!(BA,@(Ů$$(!  !0(Ǝ!(U?0$(! (Ʈ !(#2!r@".%@b2@,&!`!  ! @@$ !0A.!(@! @$@R&@&"&$(Cp!! !d$$(%! `!0 !e?12 4(Ď,&!$!(`! D !0 @. @! @@$ !0&! @l& !0(Ю40,($ 8'J<'0'40,($ ( !!8. $$+(t D C$BB$$B B$CB%C&.C0%(%(B0d&,P&'%( ! !(  $ C.D0%("%(B0$# %($p! p$ !( ?<4!0f0H!`$b8+@!(!($$!(X`\\$$!(%PX`\ &d+d!@' $!K&+@$!D\$b$+u@ $'$!Ep$!(TP$$ bt $B@!CB(VW0$! (!$!!rxt#0R !(`(9@!0@$5C$DX!@!(`&+k+@c$@$'!@$܀!(`$[b( @T$]b(U@T\^ $Qk`$Ob| $Mk$$+@T܀0 !(tT  @(.!. @@\s@!0R@!(}! !8! \$ $$ $\@`H>X!T$+T@&'$!pC&+u@Pc$!Ic$+u@$' $!K$p$T+@&!pH+@P$0B$!b$+@"2B00B$!db"2$0Q$ $ @&+@P&!pH&H&+@Te!0`+@&' $!pK&+u@p$!c' $KT+@Pѐ!pQѐ&!$!0\`! !! `$!!X @H`B0!bB"B0@XH-TX`$+T@+@&'$!pD&+@$$$!b$+u@$'$!cDp$T+@P&\$!pb&$!0T@+@&'$!pD&+u@p$' $!KT+@L!pQL& L&$!vB&+,@\!($(XPB\$X`P@L`$d< V!(dXLX!(!(XD`X `! +@TdD&B$Dc$Dd++@!p@$\$$ D$$!( $ (!@!'G<$[$$X!D`\$\ $XH@܏$$2 ďh$ !(@! @`ŏ!dƏ 0!8, ,@܏ B+@P$ ¯, @܏!& `ŏ!0 !8(`ď"!8/B8 80!dƏ ! @!( ,  @܏1&dÏ+q@ Џ$$!$!TPLHD@<840X'$!8!J<'0'lhd`\XTPLH!2!2 ' '4!028<@=D!$t ! !@!$ R&*$C+$/$?$ @$[$\$<! 2@($C b!(@?$!0`!8T+ ! @$!w/$cb.$8!8$b!8s&$ `TR&t ! !@wR$bt ! @ 2($C b!(@*$!0`!8T+ $C! @w.$cbQ&V$Q&P2"($ D?$* ! Q !@?$ V0w/$bHs&@$01&?$*$R"2@2@! Љ#0! `0 /$@! Љ/$#0 (0 ! ` ,[$!/$@$+$!$/$#($b/$@!$$1&!8, @!8,!(`+h! !0@s&$  @/$+w{@e&bC!8@!$$\$2@P0S!t ! !@!1&bt ! @ PTs&+8!(`! !0, U@s&!,+c@$QlJ< @@H< ,$$$ J<<w.$d/$ RC:$TC45@T$C$!$ b(J<A(^b8B,@(!@Q&!t !@$'0&$0! `<`[$\$ @$! @t ! @S&H:$EC0!!(1&#:$b$+hG,"]$'H@!b0@!(`Ì b(@$d($ %b(@@d(Ab(@`d(b$B,@$DP$Œ@$腙 @ @$$$P$ì$8d !(@:@0& 0&/#St ! @-$!@P!]B8+@-$"[ $&!]$E<!@&\$b&`+@T+u @[ $&]$udT! `(!v!8[ $:$=$\ ${@<`&IBt@&!@5J]$BH&!@c$ifd$E,b]$DP r$Tc$!@ bG.$B\@$BYGC&b]$VElBR&C!@C&c$bK@$.$DTc$b]$ETc$b r$]$C!@(+P!8:$ 2@($Cb! !(@!0`!8T+ !@$b(! `2$b"w$bT$ s&w$bt ! @V$!8s&!Tw2 @P$b/B8$! ! @l!hd`\XTPLHp'! !00, + 'Jb+$b?$wb@$bV$|$2B8$B,$,¯!2d2B$c80¯$$v,!Q2dTR& VR&4Ǐ(#PB$B$$$Db$<B,@!(b$#Ԅ'& #0E܏@Ю!P&dR&lƏ! @!(!80 @܏{!$0 !܏!(! @lƏ q@!8!8/B8 800 !܏!( q0ď]@lƏ!8/B8 80 T@܏&lď!+!0!(!8 q@ ďI! įlƏ! @!(!80 =@܏$$2 ď$ !(@! @lƏ! 0!(!80 +@܏ B*@P$ ¯0 @܏!& !(!0 !8',Ǐ/B8 80!lƏ ! @!( 0  @܏1&lÏ+q@ Џ$$!$!\XTPLHD@<8`'7V"!J<'0'lhd`\XTPLH!2!22 '4!008<B@ @!$ B!CU!$s&*$D+$/$?$ @$[$\$<! 2@($c b!(`?$!0!87/ ! @$#/$bT.$8 `!8$d!8&$u s&0@ B!CU0` 2($c b!(`*$!0!87/ $C! @.$bp&V$p&q2?$($ D* ! P !@ 3V/$E&@$&3*$"R 2@2@! ,! #0 /$@! ,/$ (!  #0 ,[$"!/$@$"+$"!$"/$($b/$@!$$&!80 @!8,!(+! !0@&$ " @/$+@&C!8@!$$\$"02@P0 ! B!CQ&  B!CP V&+8!(! `!00 Q@&!,+@0L$J< @@H< ,$$$ J<8.$b/$ Rd6$bTd41$d$!$ (J<A(^8B,@(!`q&0 @v0 B!CV0&2!@<`[$\$D@0 R0 B!CRA&3B:$0C!! 1&&0b$B0E,:$b@"]$ C@@腙!@ @ @!@$$ !d$P$F 0&! @8 !(@?@0&4"@0 @P B!CR-$d!@P!]B8+@b0$V[ $-$E&]$d<c0&\$b&`*@T+v @[ $&]$CT!@(!}!8[ $=$\$@<&Hb|@&!`8I]$b:$C&!`c$pfd$B0E,:$]$bDPs$Tc$!` bG.$ba@$b^Gc&b]$[Elbs&C!`c&c$bP@$.$DTc$b]$ETc$bs$]$C!`(0P!8?$ 2@($cb! !(`!0!87/ !@$b-! `2$b'$$U$& $0  B!CP$!8&!u02 @P$/B8$! ! @l!hd`\XTPLHp'! !000 + 'J<@0'!D<840,(؈HįLů !$WC܏䇙 ' $! H'!0 !8 P$K܏䇙!8 ! L' !0T$B܏!+p@@<+b@b.@ $#'` ܏@!@ $ $܏2C䇙 '!0! @H' !8 ܏!P䇙! !8 L' !0$#0$p8!0p!(0! @, c.܏`!@l ! @܏LЏ ! 8Hď!(!000 ܏!@!D!@<840,(H'$  !p%#P*I@ !8!0!@!#L!8!0!@Œì$$* @% #hŒì$$* @%!Xi*@*l@#H $!C#d$ J<'0'd`\XTPLHD@hbl!t8b@ `b@Pb'À$bb` b$b @$@H< ,$@!$că-$+$$b`'`$`b$b-$b+$bTƒ'ƒ8:B8c `8bp@tc$b*b@T$cc b*b@T cc$!bTp$c bCbbl3 !(`bT b-$-$clh! *g@e$FTe@Pe$cphRdl!bDH< @ҥ$@$d b&Dchl3 !(` ch$dddhl c$bbTc$!E-$bTb `Ttb@P$$ eb$!-b8B,B$!btlb!C-$e |@Ppb@TfL ! @f=$!@P#0CT�$4t!!!0;!e4 ! 3@ ! 4! 0/$! $0#V1&| `" b"b "bP1& $ @l P!l@! @$RQ!@1&&0!_@l\@8BPp)@(H<$<$! $ 0cl!g!  !(@H<lP$ 'BF$ !(R@E  $Rp(H@lKCHIJX\ `$(8 ,0!0` `!8@@$(0c$*b8@P$(!CC$."-$(0$*C@!(!GE.$:$ =$T[$$$0@P[$$$ $$]$$^$T$$$$',($P$!P!!H%b($$$!CBHc$$!*D@T$P!8GPD(!CB!CB(! !F(!8G(#$b$b$pb$8*}@*!@$$$ $] $ $"8XT(K5@P(L*@(!CBKP !CD!D!CG$@PP$!F N$$ !DBK$c$!f*I@T!f(!F!C$G(D$!bg((8*b3@$T!CBMb$!H% G%$(!H@&$$$$$! $! bT UDa= '$b $"! $,!($0'$b<%C!'d`\XTPLHD@T!$d'  $pxc0$!((r$, (22!t!04T8!CQc!bD$$: $FTR&>4$@ $"r,t!C(QT0Pb $b @Pbt!VBG! 21@T$/!!(!0> $'C@04#T!@P($b@&8 R&B $$`PR&B !R&$*B@BB0$d`\XTPLHD@h'l!0!8 $t!BB*E@Tf$!8`!C*@Pip*@$t p!bE$!'LHD@<840,(Td!!!(!X!? $! `!(!? !@H!!R$D$0ptb$! !b*@t *v@$&$& c,%( ! X! `!0> !@$!RBtc0Ep!e*@$ c*u@$&$& c,%(! `! `!0> ! @1&$*"@TLHD@<840,(P'J<'0'!`  !@ $  'J<'0'$ `$!$ !@ $Q!$ ('J<'0',($ @$!!! b!` $!@'`!8@8b@8@)@1$!0!(b$@Ѭ@bc$! c!0!ь@C<4?b&B,@$b $B0C*C@ CB!q!bBd!QDB!CD w1& CBCB*>{@TB Q T! BC@D#0 ! $'C!D!T!CC@B$!CBPB!(* @*`TB$'BC!!b$''!( G&!@B,@ ! cP!@Ѕ$'! !(@ 'b!@D! Y!($SRD$D!+@ B @TLB`   B@ $LB@! D B!DCc$+q@ $LBD! $' !0C D! !b"&w($g&$ BC!E!eF$h+! +!0t@$0B4C#0!F*`0B8B!F8B$D0C!*!t bV!D! !( !0`LB @ !!(t!DC$c$eT BB1&!C#&W!s $1&!DE$*#@TB0!tb&B,@$&b $B0C*C!@ BC!T@D!CE!EB!QELB@PB B!CTB!CE$& b1& CBCB*>@TB TQ!!`|xtp'J<'0'$ !0#$0*! b"#!P@%!CD!D #!pb&*@$ 00 ('J<'0'\XTPLHD@<8!*!!`#PB(@T,%,%4&2$$K' D0%8&<#  L !"!"`R0" "*b@L#`!0& '!(!!CC!C*c@* s!0&*@T!*s!!0!  J &&<"*f.@-V," "!CR'SV,"$#0!(0 !`$&!( #0" ##S#s" #! "!Pc!E#rC&"(*@$,K","4$#U!S# $! #p0"$8$bpL &^ "$ $!CBSc$$!CB Ec$&*@T"V " "!CB#S@"!$"!DE& *f@c$!  J e&P#c( `<"&$#0(!( 0K" @P"$� !(" ##S#s" # `>,"4##U#u!S!s0"8#L P%(@ I"C@P ##$#e!d!B+ be& D!E4$B01DP&0"@#!B#0P`!(($ !G$!(@#!bb$$$'$''$ ! S!@#+b@b,@P ##!b"$ ;  #+@P #"4&!b$',"#&%#R,0!( !0!@B$B,@`P!R!"!RP0,#"$!r*U! @!8#U"$'!0 J ! <"N" @ $P !  @_$ $!M"@$!$<#"/@P "!$"!DE& *f@c$K"@P"$ $" ""#!S@%!CP !PD$< !(@$ $!M"@$!<#K"@T0""!S"0"8#P$#s#(S(58#0%H"@J ! )@*\I !  K" @P%H"@P@"L ! ( @P( $#&*e  (b#!F!CD@"#!DB!fb$*@T" &&( !\XTPLHD@<8`'J<'0'$ $@!@d$$ (4@dH@Pb(@! $ J('L ! b(@T@I ! $@$$0!0*  0b!E!CD@!DB!eb$*@T  $$!  ('J<'0'$ $!*!@h0*b @! *C @*20*b@*2! N E&@!@*2 @!d$& #0Q! D0 !(h!$!` ('J<'0'D@<840,($ ʌ!H!@!!!!DB!*j @c$D $$(Cp B%!Xhl !H !CETT)%4B0QT)%(Q)%!0 $!F!fDb$$D)%*,@Tb$8$ $@!@S$! `C !(@l ! 4$$C#2%C4"2(62!8!e>2!CB!bbeQ0$TbV RR&b4B%bc0$@$ %$4B4$@B44A RR&(S"2`  $D@(! @C !(B@4!8B44"2@"2# G"2@"2 # G"2@@"2# G@"2@PR&TR&# G$*@P$b$$0( !Fc!EC$$*@$$R&*B@T!(! C !0@!(\A ! H $b!(D!@<840,($ H'J<'0'<840,($ !!!T!8$!DS!bb0VTc b(,@PPbB0'@P|#" bT|"$( @"@"0|"$0$$ !|#$!c`s|"!cB$w|" *B@R&< $<840,($ @'J<'0'40,($ Ɍ!! !! !b!DB!B*i @c$D $$B(Cp "%!P`K!@!CEBV%!0 $c!F!fDb$$ Y4%* @TB$8$ $J@!@Q$! C !(`@l ! ?(h!8 $ $ $ $) $!CB!0bŐT4ŒB0@P$4ÌB%CB0@$ %4 B4 @B4P4ŒB0@P$4B44$*@Tb!(! C !0@@!(\A !  $!(4!0,($ 8'J<'0'TPLHD@<840!!(!!d!? T!@$|b$ bp'(',tŽ(!CP! < !(j@C B#C!^'~TdŽ $(r! !BP< !(Y@!(? ! dh! !(E ! !(UD !@$l !@%%C@D`P 0B!`!S B!d@pQ$! < !(0@!( C ! !(! D !@@`,l $ $ P!(? ! @!@,!(!0P dЎ!l$ dŽ!SB@TB@R&!T!PLHD@<840X'J<'0'D@<840,(!!!!!''CE$@f$`P1&=C ! !(@!0`P $l @1&R&&*5@! `!D@<840,(H'J<'0',($ (!HE%$JTPˌŒ!@G,@T!0Ì$*C@,@8@B,_$, @,$#$,!@!'! @,$$,@!'! @,$$, @!'!@$$,@!'!!'*b@! $c$B8@B,*(q@$T,$b$$Ȍ$ $!CBJc$1&!'*H@TŒ$$k"R!@0@0Œ!GC $`b0`@,Œ!GBZ@P!Y,U"$TT!2 B@$$B@$B @!$bUŒŒ!GD!CD!E!B!DB*bR! *e @c$! B!C E@$B*8! `@& E !B!DB*b@*eB!DB*S@P! *e @c$!! BB0@!``T!*$ C!,! ($ 0'J?  @T&LD !( @ $&Hb*@TbL! !(X !0@8c$84c$@4x@D0l(0 t0plhd`\XTPx'J<`'0'|xd!CdC䌠b$!! C Td"!C@$'!(!0P $$& !@B@F&Q&? ! @$!  $!EEpUD !(C@$(*! @&F&! E !(!@ $k  b@Pd$t`\!"\!CB$Dpb*Er@P&b*En@T&b c!R`e!$$!0 $!CD!CiT $B BV! $iT! BBR!! $!(*@! !0tF !89@!=&!CS $br< ! @!(< ! @!(`! !0tF !8@&&*@!(&!DE!bbB$B, @Pb BV! !0tF !8@ !@ *@&&`b*}@`  d!(!0 'P !   ddb!DB4BB0@P!! `!? TwXX$$p$('8'B$(HT!hlp!CS!CdC "Q&$bT& $brHPtb XL!E!xST #C@!" L!CP!DBQ *Rd@T!CB^@PD$< !( X@T!0`>? O@( @h $lC TM@!@l!(0D 4@C $(dh!CKW P9@!@(pQ ! /@!@d(l!EP< !(D$!(@<*@b$0<(@!Fc!EC$$<*@$t"!U@&&&&*a@T!(@l @!! |x'J<'0' ` ,$@!@H'! !(,@0@  $ &h''!!e Œ8!GB!bbe$S0e< ! O$! E%C$$>$"\B( @! <%C$$$  $@B0@! < $b$$!  $@B0@! < $ŒB0@! < !(N` b2@b2! < $!@! !(  $! < $b2@b22@b2$bB0@\B(@!0 <!8!(!!B`d'Ì%D$C¬%8$ $$ ! !8`$$C$%8b2@T!!!!$ ŒB0@P\⌘\B(@!0 <!8!(!!B`cČ$C'$D¬%8$ $$! !8`'$C$%8$w$!0! < ŐH@!0!(!!%Bc$C! %0$ $!8Ps&!8 !@!!0!E'$E'$d! %@$ $%$Q@!! d  $!   $ $Br!(C ! w;@R& ! !ED E1@ s& & & ' &*r@r@!! !(   $ $(Cr ⌸! !F? E@R&! !(  $$b*@!@! * $l&@$@'l ! L@$$ $,D+! ? E& @U$.?$vB$6S$LW$>`$Nb$(s$>w$0{$n|$}$$V$p22@$2@T$ $@T$&b$b<$@T$6$<$ @T$0 $<$@T$*$<$@T$$$<$@T$ $<$@T$!$<$@T$"$<$@T$#$<$@T$@$<$@T$$b $ 2@T$$ 2@T$ $2@$2@P$$2@$2@P$$2@$2@T$$@$2@T$$bP"B(@P("#!br ! @@$_B:D,bDe HL!0T ^!@$CP!( $CP!(T2T74n c `!@@ @TT"!DE!SC%dC$@1&XBB4XB5&s&uRB!B@ $ B@! $|` @<$<'! `!(T$ l+$ h\B<|XBB0XBtB0p! `C &F@! @@@@\BB(@<'J ! 8@! @\*T4@X\B`!C*E/@T ! C @(@! @( L <'B(@I <'!  `lX*  bT!E!CC|!CC@!EC$*@<\X\X! B ! &B <'('<'<%0d!(! e !0  '! !(n !@ @ !! `!(!0`@ $ !@! `!( !0`@ $R $@ $ !@4B`$ $  $`   "$ p` "$ p` " #! @`""@T" $`  "@! "4$!CD$+@T"4$E $<$! (, !Q$%!! @#!0 !(`!0`$!(,(!@ !`D$+e$!E$ $S% !@!H$!H<$% 0#q%(,  !(`` !0 # (,  'D@<840H'! $#F@#E!E%b! @!(`!!! $#F@#D!D%b! @!+ @!+@$+@!+@$$!`<'!<+@,E,(<+@$$!CC $#E#C< '!'40,($ b,@$<4% $!@r!nb$b%S!!k!0i@!0(?@($#D9*!@#@!H!0! @ !(`!0`$!(!` !@E$d$+!D$$S! !( !0 !8$C%@$!%@%H51$b%1@%!@+H!I!@`!H@<+"@!0$ %R& !@C2$b$B2 @B&!@B&!@+R!S!`!@ <+b @"B /%(B !!$".%("!!!!$<04-$ % 4/% !@!0,($ 8'!8F0= %d setsockopt SO_REUSEADDR failed: %s Connecting to %s|%s|:%d... Connecting to %s:%d... Connecting to [%s]:%d... setsockopt SO_RCVBUF failed: %s %s: unable to resolve bind address %s; disabling bind. connected. failed: %s. %s: unable to resolve host address %s .A/index.htmlorig.origCannot back up %s as %s: %s ?#%;%d; URL=%sConverting links in %s... nothing to do. Cannot convert links in %s: %s Unable to delete %s: %s wb/:./../%d-%d Converted links in %d files in %s seconds. XCannot open cookies file %s: %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. TRUEFALSE %s %s %s %.0f %s %s Error writing to %s: %s Error closing %s: %s %lfdomainpathexpiresmax-agesecureSyntax error in Set-Cookie: %s at position %d. Unable to get cookie for %s Cookie coming from %s attempted to set domain to .com.edu.net.org.gov.mil.int?==> AUTH TLS ... done. Server does not support AUTH TLS. Falling back to FTP. Error in server response. Closing. Length: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) anonymous-wget@Could not initialize SSL. It will be disabled.Logging in as %s ... @Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> PBSZ 0 ... Server did not accept the 'PBSZ 0' command. done. ==> PROT %c ... Server did not accept the 'PROT %c' command. done. ==> SYST ... Server error, can't determine system type. done. ==> PWD ... ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. Logically impossible section reached in getftp()cwd_count: %d cwd_start: %d cwd_end: %d []==> CWD (%d) %s ... No such directory %s. ==> CWD not required. ==> SIZE %s ... File has already been retrieved. ==> PASV ... ==> EPSV ... ==> LPSV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s port %d: %s ==> PORT ... ==> EPRT ... ==> LPRT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %s ... REST failed, starting from scratch. File %s exists. ==> RETR %s ... No such file %s. ==> LIST ... No such file or directory %s. accept: %s ab%s has sprung into existence. Server does not want to resume the SSL session. Trying with a new one. Could not perform SSL handshake. Resuming SSL session in data connection. %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. byteData transfer aborted. 425FTPS server rejects new SSL sessions in the data connection. No such file %s. File %s already there; not retrieving. (try:%2d)--%s-- %s %s => %s Server does not support AUTH TLS. Server does not like implicit FTPS connections. %s (%s) - written to stdout %s[%s] %s URL: %s [%s] -> "%s" [%d] Removing %s. unlink: %s %s (%s) - %s saved [%s] .listingRemoved %s. Rejecting %s. Error matching %s against %s: %s No matches on pattern %s. %s/%sNot descending to %s as it is excluded/not-included. Remote file no newer than local file %s -- not retrieving. Remote file is newer than local file %s -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory %s. %s: unknown/unsupported file type. Failed to set permissions for %s. %s: corrupt time-stamp. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. 6666677666666668777666777777666666777777777767767777776out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundZddZZZZZ[ [[[$[,[4[<[D[L[T[\[d[l[dddddddddddddt[|[[dd[[[[[   ! "#$%&'()*+,-./012,3456,,7,8 9 , :;<=>(?@A,BCDEFG,HIJK,,L,MNO PQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ+)) )  )))%) ) )))   %$%########### (   ###!################  #####################!###"################################## ## (  ###########################!!######"##################################### ########################  '  ###################################!!!!######""######################################### #### '  #################################!!######""""#################################### #### &'  ##########################!!#####""############################ #### '''############!!##""####'''''###""'''''''&'&'''''&?_________wwwywJJRTWw____wJJREEEGEEKKKKKKKKETTKEEEuEuuxxxxxxxxxxxxxxxxxxxxxuu+++222++++++++++o               8 ,/ ?ACDNOST?A[NOST?NOST?NS?  pCPUhT QpCpCL pCRpC pCpC pCpC} 3gpCQU {Wl f } pCH )G 9@AsNy&lF X F]TpCw\mpCpCZ Y F# ipPpCL z!  Hk  vk  P   W-Sm[  >'(9 HQL< k  h c d ,I j u l p) } D t E < \ [ e9 2 1 dM K K4<$,>\opC{;e@ ? H8 H =\(~(    k z  79   .c / xt  }   i  4aORy U   3UNjun 7 Fc t _ypC  pC I  4  c l+> oT G @H G 3      3 3N " <^ T1  e }  0     M # ( -    2  7 k &   = T Y b Y _ L QpC Y 1 m  /m$aA 0  {  ~ U C h ! \ D / O m ,  2  : N l G [\ '  5 ? TP ! < \ a s  sx q ^( Fx $R< cpCQpC}^ % _BV{=z t V~?+  Ko T}!|}_ Y  ` a +R<5 . 0UZV_dmT rJ#8F\sx[6-O, P' ($#SO3l\ 7B-2Ea ig>C F  Fbglq kw~pCq)b FPg Fq F j>03l/hQMpC  b F > w !:!s!!!"W"""#X##t# $I$ $$$m9 U02%k%%%L.&g&&&'K''''K(n (((&p <9)r)))5*n***+R+++ ,C,, ,C( -TE----3.u. ./G//\/|/b;0"w00$0+1d112D222#3 (Y1_3`x.} m334  *R44m l45?5x556;6t6667]7778888 F "879a99 9:':Q:{::  o::#;M;w;;; pC ;.>7>:>>>G>P>Y>b>k>n>w>>>>>>>>>>>>>>>>???!?*?3?>>.d....%%%%%ccbAAAc     dd3333344444d bb 55555 b;;;;;`[[`m`[[`mf-----mm'66666YgfgF'gFFFFf--gfg<<<<<-YYY=====]]]]gkg]kkkkiGiGGGGGGGGGDDDDD\GG\\\\D\HHHHHHH\DD\JJJJJJJ77UUUUUutU!qoUU!*"0"0'2I*2IX?'J??EEEEEEEEEEJNOEEEEEEnhXrLLLLLNOEEEEEKKKKKMMMMMhNNNNNfKLKKKKaLOOOOOr_LLKLM[hKNMhMNZRhKNRRMQSOhWQNMhNOOPPPPP^////OSQQQQQORRRRRDVVVVVCWWWWWPPL^LTQP^Q^=VPPQj^RViTQR<^Q%R^9%W%VViWiRiVWiRSSSSSj8^W3`iWijjj71jF7c7n`Scnnnnfj;jSf;F;nSFS|S||S-S,nSnSTTTTTh)ThTTTT'vvvvvTv3&3vvmmvmTTuuuuuuuuuu]]]]uuuuuuvuuuuuwwwwww44ww{{{{{w{{{{eeee{w#####{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}$$$$$@}}}}}}}}}}}}}}}}@}}}}}@@(((((4444455555~oCB@?9720,+)@@66666  @:::::AAA      1H (1H(.....JJKKKKK>>>>>          .(      LLLLLU.>]Uj.]j          > > m  m PPPPPvrqpQQQQQnmig UUUUUEEEEEVVVVVcb^\YSEbbbbbcccccNM@EEdddddjjjjj>30.*&!kkkkklllllppppp|| \\\\\\\yyyyyyyy\vvvvvyyvvv{{{{{{}}}}}{{{{}}}~~~~~xxxxxxxxxxxxxxxx~xxxxx~~*****------5555555BBBBBBCCCCCC            ((((()))))*****             ...../////()*00000       .      ./.MMMMMTTTTT0TTTM                                                                                  1111199999199988888:::::88:iiiii_____8ii8:_i:_;;;;;<<<<<=====>>>>>?????DDDDDEEEEE;<=>?DDEFFFFFDGGGGGHHHHHIIIIIJJJJJNNNNNFOOOOO           G NHIJNNO !!!!!!!!!!!!WWWWWyyyyyWWWyyy!"""""""""""W""#############$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&+++++++++++++++++++++++++++222222222222222222222UUUUUUUUUUUUUXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYZZZZZZZZZZZZZ[[[[[[[[[[[[[\\\\\\\\\\\\$$$$$\]]]]]]]]]]]$]]^^^^^^^^^^^^^____________!!!!"""!""_``````````````````````!``````"``````aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaddddddddddddddddddddddddddddeeeeeeeeeeeeeeee%%%eeeeee%%%eeeeeellllllllllll)))%+++))++---+...--..lmmmmmmmmmmm)m+22222KKKK-22.K2LLLLLmnnnnnnnnnnnnIIIIIKIIILnoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooppppppppppppMMMMPPPMPPQQQRRRQQRRpqqqqqqqqqqqMqPQRqrrrrrrrrrrrrrssssssssssssstttttttttttttuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvzzzzzzzzzzzzz|||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~                                                                                                                                                                                                                         #############################&&&&&&&&&&&&&&&&&&&&&&&&&,,,,,,,,,,,,,,,,,,,,,,,,,,,,,/////////////////////////////5555555555555666666666666677777777777778888888888888888888888888888888888888888888888888888888888888888888888888888888889999999999999:::::::::::::;;;;;;;;;;;;;<<<<<<<<<<<<<=============>>>>>>>>>>>>>??????????????????????????????????AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEEFFFFFFFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[bbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeefffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~                                                $$*EO$`^ $_Ee$Okaf!^` E,l3e)G%kt)!"----------G%)ut(""/ghZG012222222222"Sg|3345637893:3;33<=>3333?33456789:3;33<=>3333AE3EB'HCiDbjecAdfBCiDb<H=ec$GG----------HJJJJJJJJJJE|JJJJJJ----------#%p$JJJJJ##Q$$Hq rsGGpRRRRRRRRRRqr(RRRRRRE$<%=()%RRRRRTTTTTTTTTTsTTTTTTjGm)nvoTTTTT((VmnWWWWWWWWWWghmiWWWWWWjP]$gicWWWWWJJJJJJJJJJqJJJJJJjq%]JJJJJvv]Uvvvvvvvvvvvvvvvwxxxyz{|xxvvvvxxxxxx}~vvvvvvvvvxxxxx}~vvvvvvvvvvv11ktUJl$kutIIIIE 1)1 sQ$GPP $s$p!"q#rsp%%SSSSq r  %35rI3*t+,E r5'UUtV.W$/012oVWGABC]E)xxxxx]mnvvvovvvvvmGnvvvvvvvv6789:FFFFF]]>?@^v]_h^hvvvvcSTUFFFF&ghe'(f]g eSTUFFFF) kt)ooopol#kut#F`$a]F`$4h4hf6cQ]]]]^]Q6QbcGdbccGFiKLMFNOPjaPQRNiiNQjRiKghgKMMEFFFGHIJFFHLFFFFFFZZZ[Z_HZLFFFFFXXXYX___`_FaaabaPF\]FFFF'\`QcccdceFaBlPf\C^Da'\\U`Qe_De\feeefe^ghk\tlUe\iD\ggghg9jegut \i%!k"&'\eeefe9lXkmmk\8nnooFl8mmkk]nniiijilF^V5]kggghg_]5vvvvvbx]^kyVz{\q0rbs+kkb,l-m\cnd0qorlllmlb|dmcnF..HFFFFIJdn]un)))*)-uuuuuuuuuu-uuuuuuIJuuuuu}}}}}}}}}}xxxx}}}}}}/+,0123(}}}}}xxxxooopo7;]8<9=])FM]]6N7OFWxxxxRST]qZZZ[ZWWWXWXXXYX]]]^]g___`_\aaabaY]aZ[I^mJ\bnom_\cndeo^fbQ\m] \cneghcccdc]\eeefegWWWXW]ggghgeeefe@Aggghg\isb(tkuj]c\d^_`a\ilibmkpknc\omlqnrmskopniiijipm qnrqKrLspcqr\qrs???@?\)qrlllml)h]A*vvvvvvxyzvA*{vpu                Q|/epfghi]          /z      ]]jjz qqqrq]]|xxxxc|   IIIIc\?\]]1}~x<wE;1PP$<w;23E4=>>>}~x)))*)=>%SSSS?xxxx:&:]?]55&&&&&&&&&&&&&&&&'&&&&&&&&&&&&&&&..(&UU$(xxxx ]BCKooopoBC)]xE]]]^]XXXYX]xExxxxyz{|xxxxxxxxxxxxZZZ[Zb___`_^cdxxxxx_baaaba^cG]cccdc\eeefe\ae(Gf]\\\egh\ik]\\jggghglg\ikv\lllmleeefeD(Dggghg]]mxxxxn];;]oxxxxx]mk niiiji4umlxn4k-o     H-]mIzn1H]v_P\q]r]sI]\???@?q]r1 G]j _]_     ]]GHz ]     ]]]]z ]]]]|  WWWXWWWWXW]]]|]Z']][ZX'NqqqrqMLK@.|_'     z      z      z|      |z ||zooopo |   IIIIPP$XXXYXPP%$)))*)^_]]]^]^%bcccdccdUUb$cijaaabai)___`_ZZZ[Zghgeeeefefaeggghgiiijilllmlkeeefelggghgkmnoqrsk%munlqrmknom&n???@?        z :|:WWWXWWWWXWqqqrqvvvvXXXYXZZZ[ZcccdclllmlO`]^tO_ia`^juti    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   )))*)zeeefe &&&&&&&&&&(&&&&&&k|&&&&&IIIIlkFFFFFFFFFF(FFFFFFaaabaWWWXWFFFFF&&&&&&&&&&(&&&&&&ooopoWWWXWgh&&&&&(((((((((((g((((((]]]^]___`_](((((((((((((((((((((bggghgcde(((((fbiiijiceeeefemnopggghgmnqrkspvvvvvvvvlqrkmnovvvvmnvvvv] QRiiiiijhk]   vvvvvxyz{ STTTTTSSSV |W]]]X Y ]qqqrq]( Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\ddddddddddddddddddddd]eeeeeeeeeeeeeeee???@?eeeeegiiiii(gggjm;niiiii_____jh;kklopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrxyyyyyxxx{|}]SSS]]]]]]]]]]])))*)     z ]???@?|WWWXWWWWXWqqqrq%]]]]&~    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   z |(((((((((SSS((((((]((((( Q   z Q   |    SSS       %'SSS(   & 2222231SSS4 STTTTTSSSV WX Y SSS [[[[    Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\SSS%giiiiigggjmnSSS%%om&22222314giiiiigggjnIIIII`caopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrgiiiiigggjmn)%%ogiiiiigggjmn&&ogiiiiigggjmnogiiiiigggjmnomgiiiiigggjnogqqqqgggjmno Y ~z |(((((((((((((((](((((STTTTTSSSVWXSTTTTTSSSVWX Y  [    [[[[       xyyyyyxxx{|}giqiiigggjmnogqqqqgggjmno   ~z |STTTTTSSSVWXSTTTTTSSSVWX[[[[    gqqqqlglllggjmllllnllllllllllllllllllllolllllllllllllllllllxyyyyyxxx{|}                        ~[[[[                                                                        !"!#####################$$*+,,,,,,,,,,,,,,,,,,,,,-.-/////////////////////02222200036789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;AAAAAAAAAAAAAAAAAAAAA~BBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDD[[[[           EEEEEEEEEE    EEEEEE                 EEEEE                   FFFFFFFFFFFFFFFFFFFFF                     LMLNNNNNNNNNNNNNNNNNNNNN!"!OOOOOOOOOOOOOOOOOOOOO$$*+,,,,,,,,,,,,,,,,,,,,,Q))RQ%SSSSSSSSSSSSSSSS&SSSSS-.-TTTTTTTTTTTTTTTTTTTTT022222000367860222220003V789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;022222000367802222200036780222220003678022222000367860222220003V780:::W:000367XXXXXXXXXXXXXXXX8XXXXXYYYYYYYYYYYYYYYYYYYYY~ZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[[[[[    gqqqqgggjmnoLMLbbbbbbbbbbbbbbbbbbbbb!"!cccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeexyyyyyxxx{6|}02:2220003678fffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~$$$$$$$$$$$$$$$$$$$$$555555555555555555555########&&&((((((((++FFFFIIIIIIIIPPPPPPPPPSSSSSSSSUUUUUUUUUYYYYYYYYY\\\wwwwwww~~~~~~~~~        ~~~~~~~~~#########(((((((((         wwwwwwUUUUUUUUUbbbbbbbbbggggggggglllllllllzzzzzzzzzSSSSSSSSS         UUUUUUUUUbbbbbbbbb         xxxxxxxxxggggggggglllllllll\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzzlllllllllwwwwww\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzz         wwwwww$$$$$$$$$)))))))))000000000555555555GGGGGGGGG        $$$$$$$$$)))))))))000000000555555555         lllllllll\\\\\\\\\^^^^^^^^^bbbbbbbbbGGGGGGGGGxxxxxxxxxzzzzzzzzziiiiiiiiitttttttttzzzzzzzzz{{{{{{{{{url(type=--> %s --> PASS Turtle Power! SIZEPWDSYSTVMSUNIX215 UNIX Type: L8215 UNIX MultiNet Unix Emulation V5.3(93)WINDOWS_NTWINDOWS2000MACOSOS/400RETRRESTCWDTYPEEPSVLPSVPASVPROTPBSZAUTHTLS|%d|%s|%d|EPRT%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dLPRT%d,%d,%d,%d,%d,%dPORTUSER331 s/key 331 opiekey LIST -aLIST ���Index of /%s on %s:%d��� 

  %d %s %02d %02d:%02d  time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
rbtotal -> ..MTotal of .DIR.DIR;1%d-%b-%Y %H:%M:%SWGET_TIMEZONE_DIFFERENTIALUnsupported listing type, trying Unix listing parser. JanFebMarAprMayJunJulAugSepOctNovDec );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[m?Resolving %s... failed: No IPv4/IPv6 addresses for host. , , ...index: %d al->faulty: %d Error in handling the address list. Please report this issue to bug-wget@gnu.org %255s %d %d %lu %lua+# HSTS 1.0 Known Hosts database for GNU Wget. # Edit at your own risk. # %s %d %d %lu %lu Could not write the HSTS database correctly. Will not apply HSTS. The HSTS database must be a regular and non-world-writable file. 8Thp%s: Invalid URL %s: %s %s: Cannot resolve incomplete link %s. http-equivrefreshcontentcontent-typerobotsnone , nofollowhrefrelstylesheetshortcut icontext/htmlactionsrcset , appletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdvideoaudiosourcecodesrcbackgroundlowsrcposter%s%s HTTP/1.1 Failed writing HTTP request: %s. %s:%sBasic .%d%sHTTPNo headers, assuming HTTP/0.9authUnsupported quality of protection '%s'. MD5MD5-sessUnsupported algorithm '%s'. %08x00000001Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", qop=auth, nc=00000001, cnonce="%s"Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="%s", algorithm="%s"0123456789abcdefBasicDigestNTLMWWW-AuthenticateUnknown authentication scheme. Authentication selected: %s AuthorizationDisabling SSL due to encountered errors. HEADGETRefererCache-Controlno-cache, must-revalidatePragmano-cachegmtime failed. This is probably a bug. Cannot convert timestamp to http format. Falling back to time 0 as last modification time. Thu, 01 Jan 1970 00:00:00 GMTIf-Modified-Sincebytes=%s-Wget/%s (%s)linux-gnuUser-AgentAccept*/*Accept-EncodinggzipidentityHostConnectionCloseKeep-AliveProxy-ConnectionContent-Typeapplication/x-www-form-urlencodedBODY data file %s missing: %s Content-Lengthpostputpatch0Proxy-AuthorizationReusing existing connection to [%s]:%d. Reusing existing connection to %s:%d. CONNECTFailed reading proxy response: %s %s ERROR %d: %s. Malformed status lineProxy tunneling failed: %s?%s request sent, awaiting response... ProxyNo data received. Read error (%s) in headers. %2d %s Transfer-EncodingchunkedSet-CookieContent-Dispositionfilename%s.tmp(no description)Strict-Transport-SecurityincludeSubDomainsCould not parse String-Transport-Security header LocationLast-ModifiedX-Archive-Orig-last-modifiedContent-RangebytesContent-Encodingbrcompressdeflatex-compressx-gzipLocation: %s%s unspecified [following]application/xhtml+xmltext/cssFile %s not modified on server. Omitting download. .Z.zlib.html.cssServer ignored If-Modified-Since header for file %s. You might want to add --no-if-modified-since option. The file is already fully retrieved; nothing to do. Length: ignored [%s] Saving to: %s STDOUT.brWarning: wildcards not supported in HTTP. File %s already there; not retrieving. Spider mode enabled. Check if remote file exists. --%s-- %s %s --%s-- %s Cannot write to %s (%s). Required attribute missing from Header received. Username/Password Authentication Failed. Cannot write to WARC file. Cannot write to temporary WARC file. Unable to establish SSL connection. Cannot unlink %s (%s). ERROR: Redirection (%d) without location. %s: Remote file does not exist -- broken link!!! Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file %s -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists. %s URL: %s %2d %s %s (%s) - written to stdout %s[%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - %s saved [%s/%s] %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T[%s][%s]:%d%s, %02d %s %04d %02d:%02d:%02d GMTSunMonTueWedThuFriSatrealmopaquenonceqopalgorithm$0q0qs$s~~~~~~~~~~~~tq0qtq0q0q0q~~~~~~~~$@(t0q~$0q~$(r~0q$$Lss~q$xrrr%s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid time period %s %s: %s: Invalid number %s. %s: Invalid --execute command %s %s: %s: Invalid value %s. bitsinfquiet%s: %s: Invalid %s; use `on', `off' or `quiet'. %s: %s: Invalid WARC header %s. %s: %s: Invalid header %s. %s: %s must only be used once WGET_ASKPASSSSH_ASKPASSuse-askpass requires a string or either environment variable WGET_ASKPASS or SSH_ASKPASS to be set. unixvmswindowslowercaseuppercasenocontrolascii%s: %s: Invalid restriction %s, use [unix|vms|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: Invalid byte value %s %s: %s: Invalid progress type %s. no_proxyWGETRC%s: WGETRC points to %s, which couldn't be accessed because of error: %s. HOME%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command %s in %s at line %d. %s/.wgetrcSYSTEM_WGETRCParsing system wgetrc file (env SYSTEM_WGETRC) failed. Please check '%s', or specify a different file using --config. /usr/local/etc/wgetrcParsing system wgetrc file failed. Please check '%s', or specify a different file using --config. %s: Warning: Both system and user wgetrc point to %s. acceptacceptregexaddhostdiradjustextensionalwaysrestaskpasswordauthnochallengebackupconvertedbackupsbindaddressbodydatabodyfilecacertificatecadirectorycertificatecertificatetypecheckcertificatechooseconfigconnecttimeoutcontentdispositioncontentonerrorcontinueconvertfileonlyconvertlinkscrlfilecutdirsdebugdefaultpagedeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleegdfileexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpscleardataconnectionftpsfallbacktoftpftpsimplicitftpsresumesslftpuserglobhstshstsfilehtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsonlyhttpsproxyhttpuserifmodifiedsinceignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlyirikeepbadhashkeepsessioncookieslimitrateloadcookieslocalencodinglogfileloginmaxredirectmethodmirrornetrcnoclobbernoconfignoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppinnedpubkeypostdatapostfilepreferfamilypreservepermissionsprivatekeyprivatekeytypeprotocoldirectoriesproxypasswdproxypasswordproxyuserquotarandomfilerandomwaitreadtimeoutreclevelrecursiverefererregextyperejectrejectedlogrejectregexrelativeonlyremoteencodingremovelistingreportspeedrestrictfilenamesretrsymlinksretryconnrefusedretryonhttperrorsavecookiessaveheaderssecureprotocolserverresponseshowalldnsentriesshowprogressspanhostsspiderstartposstrictcommentstimestampingtrustservernamesunlinkuseaskpassuseproxyuseragentuseservertimestampsverbosewaitwaitretrywarccdxwarccdxdedupwarccompressionwarcdigestswarcfilewarcheaderwarckeeplogwarcmaxsizewarctempdirxattrautosslv2sslv3tlsv1tlsv1_1tlsv1_2pfsposixIPv4IPv6pemasn1$@N@ @@u"A@0AApB @ %s received.wget-log Redirecting output to %s. %s: %s; disabling logging. 0123456789ABCDEF%s: %s: %s Usage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. %*c%s Wgetrc: Locale: Compile: Link: GNU Wget %s built on %s. %s (env) %s (user) %s (system) /usr/local/share/localeCopyright (C) %s Free Software Foundation, Inc. 2015License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Please send bug reports and questions to . %s/.wget-hstsCannot create pipe Error initializing spawn file actions for use-askpass: %d Error setting spawn file actions for use-askpass: %d Error spawning %s: %d Error reading response from command "%s %s": %s %dd %dh %dm %ds%sswgetMemory allocation problem no-configconfigExiting due to error in %s Try `%s --help' for more options. %s: illegal option -- `-n%c' Debugging support not compiled in. Ignoring --debug flag. Both --no-clobber and --convert-links were specified, only --convert-links will be used. Both --no-clobber and --convert-file-only were specified, only --convert-file-only will be used. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k or --convert-file-only and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. File `%s' already there; not retrieving. WARC output does not work with --no-clobber, --no-clobber will be disabled. WARC output does not work with timestamping, timestamping will be disabled. WARC output does not work with --spider. WARC output does not work with --continue or --start-pos, they will be disabled. Digests are disabled; WARC deduplication will not find duplicate records. dotCompression does not work with --continue or --start-pos, they will be disabled. Cannot specify both --ask-password and --password. Specifying both --start-pos and --continue is not recommended; --continue will be disabled. %s: missing URL You cannot specify both --post-data and --post-file. You cannot use --post-data or --post-file along with --method. --method expects data through --body-data and --body-file options You must specify a method through --method=HTTPMethod to use with --body-data or --body-file. You cannot specify both --body-data and --body-file. POSTbody-databody-fileThis version does not have support for IRIs Password for user %s: Password: -k or -r can be used together with -O only if outputting to a regular file. --convert-links or --convert-file-only can be used together only if outputting to a regular file. ERROR: could not open HSTS store at '%s'. HSTS will be disabled. ERROR: could not open HSTS store. HSTS will be disabled. Username for '%s%s': Password for '%s%s@%s': No URLs found in %s. FINISHED --%s-- Total wall clock time: %s Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! SIGHUPSIGUSR1WTF?!accept-regexadjust-extensionappend-outputask-passwordauth-no-challengebackup-convertedbind-addressca-certificateca-directorycertificate-typecheck-certificateclobberconnect-timeoutconvert-file-onlyconvert-linkscontent-dispositioncontent-on-errorcrl-filecut-dirsdefault-pagedelete-afterdirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userftps-clear-data-connectionftps-fallback-to-ftpftps-implicitftps-resume-sslhelphost-directorieshsts-filehtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userhttps-onlyignore-caseignore-lengthignore-tagsinclude-directoriesinet4-onlyinet6-onlyinput-filekeep-badhashkeep-session-cookieslevellimit-rateload-cookieslocal-encodingrejected-logmax-redirectnono-clobberno-parentoutput-documentoutput-filepage-requisitesparentpassive-ftppost-datapost-fileprefer-familypreserve-permissionsprivate-keyprivate-key-typeshow-progressprotocol-directoriesproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandom-waitread-timeoutregex-typereject-regexrelativeremote-encodingremove-listingreport-speedrestrict-file-namesretr-symlinksretry-connrefusedretry-on-http-errorsave-cookiessave-headerssecure-protocolserver-responsespan-hostsstart-posstrict-commentsif-modified-sincetrust-server-namesuse-askpassuse-server-timestampsuser-agentversionwarc-cdxwarc-compressionwarc-dedupwarc-digestswarc-filewarc-headerwarc-keep-logwarc-max-sizewarc-tempdirMandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit -h, --help print this help -b, --background go to background after startup -e, --execute=COMMAND execute a `.wgetrc'-style command Logging and input file: -o, --output-file=FILE log messages to FILE -a, --append-output=FILE append messages to FILE -q, --quiet quiet (no output) -v, --verbose be verbose (this is the default) -nv, --no-verbose turn off verboseness, without being quiet --report-speed=TYPE output bandwidth as TYPE. TYPE can be bits -i, --input-file=FILE download URLs found in local or external FILE -F, --force-html treat input file as HTML -B, --base=URL resolves HTML input-file links (-i -F) relative to URL --config=FILE specify config file to use --no-config do not read any config file --rejected-log=FILE log reasons for URL rejection to FILE Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits) --retry-connrefused retry even if connection is refused -O, --output-document=FILE write documents to FILE -nc, --no-clobber skip downloads that would download to existing files (overwriting them) --no-netrc don't try to obtain credentials from .netrc -c, --continue resume getting a partially-downloaded file --start-pos=OFFSET start downloading from zero-based position OFFSET --progress=TYPE select progress gauge type --show-progress display the progress bar in any verbosity mode -N, --timestamping don't re-retrieve files unless newer than local --no-if-modified-since don't use conditional if-modified-since get requests in timestamping mode --no-use-server-timestamps don't set the local file's timestamp by the one on the server -S, --server-response print server response --spider don't download anything -T, --timeout=SECONDS set all timeout values to SECONDS --dns-timeout=SECS set the DNS lookup timeout to SECS --connect-timeout=SECS set the connect timeout to SECS --read-timeout=SECS set the read timeout to SECS -w, --wait=SECONDS wait SECONDS between retrievals --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals --no-proxy explicitly turn off proxy -Q, --quota=NUMBER set retrieval quota to NUMBER --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host --limit-rate=RATE limit download rate to RATE --no-dns-cache disable caching DNS lookups --restrict-file-names=OS restrict chars in file names to ones OS allows --ignore-case ignore case when matching files/directories -4, --inet4-only connect only to IPv4 addresses -6, --inet6-only connect only to IPv6 addresses --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none --user=USER set both ftp and http user to USER --password=PASS set both ftp and http password to PASS --ask-password prompt for passwords --use-askpass=COMMAND specify credential handler for requesting username and password. If no COMMAND is specified the WGET_ASKPASS or the SSH_ASKPASS environment variable is used. --no-iri turn off IRI support --local-encoding=ENC use ENC as the local encoding for IRIs --remote-encoding=ENC use ENC as the default remote encoding --unlink remove file before clobber --no-xattr turn off storage of metadata in extended file attributes Directories: -nd, --no-directories don't create directories -x, --force-directories force creation of directories -nH, --no-host-directories don't create host directories --protocol-directories use protocol name in directories -P, --directory-prefix=PREFIX save files to PREFIX/.. --cut-dirs=NUMBER ignore NUMBER remote directory components HTTP options: --http-user=USER set http user to USER --http-password=PASS set http password to PASS --no-cache disallow server-cached data --default-page=NAME change the default page name (normally this is 'index.html'.) -E, --adjust-extension save HTML/CSS documents with proper extensions --ignore-length ignore 'Content-Length' header field --header=STRING insert STRING among the headers --compression=TYPE choose compression, one of auto, gzip and none --max-redirect maximum redirections allowed per page --proxy-user=USER set USER as proxy username --proxy-password=PASS set PASS as proxy password --referer=URL include 'Referer: URL' header in HTTP request --save-headers save the HTTP headers to file -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION --no-http-keep-alive disable HTTP keep-alive (persistent connections) --no-cookies don't use cookies --load-cookies=FILE load cookies from FILE before session --save-cookies=FILE save cookies to FILE after session --keep-session-cookies load and save session (non-permanent) cookies --post-data=STRING use the POST method; send STRING as the data --post-file=FILE use the POST method; send contents of FILE --method=HTTPMethod use method "HTTPMethod" in the request --body-data=STRING send STRING as data. --method MUST be set --body-file=FILE send contents of FILE. --method MUST be set --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL) --content-on-error output the received content on server errors --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge HTTPS (SSL/TLS) options: --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, TLSv1, TLSv1_1, TLSv1_2 and PFS --https-only only follow secure HTTPS links --no-check-certificate don't validate the server's certificate --certificate=FILE client certificate file --certificate-type=TYPE client certificate type, PEM or DER --private-key=FILE private key file --private-key-type=TYPE private key type, PEM or DER --ca-certificate=FILE file with the bundle of CAs --ca-directory=DIR directory where hash list of CAs is stored --crl-file=FILE file with bundle of CRLs --pinnedpubkey=FILE/HASHES Public key (PEM/DER) file, or any number of base64 encoded sha256 hashes preceded by 'sha256//' and separated by ';', to verify peer against --random-file=FILE file with random data for seeding the SSL PRNG --egd-file=FILE file naming the EGD socket with random data HSTS options: --no-hsts disable HSTS --hsts-file path of HSTS database (will override default) FTP options: --ftp-user=USER set ftp user to USER --ftp-password=PASS set ftp password to PASS --no-remove-listing don't remove '.listing' files --no-glob turn off FTP file name globbing --no-passive-ftp disable the "passive" transfer mode --preserve-permissions preserve remote file permissions --retr-symlinks when recursing, get linked-to files (not dir) FTPS options: --ftps-implicit use implicit FTPS (default port is 990) --ftps-resume-ssl resume the SSL/TLS session started in the control connection when opening a data connection --ftps-clear-data-connection cipher the control channel only; all the data will be in plaintext --ftps-fallback-to-ftp fall back to FTP if FTPS is not supported in the target server WARC options: --warc-file=FILENAME save request/response data to a .warc.gz file --warc-header=STRING insert STRING into the warcinfo record --warc-max-size=NUMBER set maximum size of WARC files to NUMBER --warc-cdx write CDX index files --warc-dedup=FILENAME do not store records listed in this CDX file --no-warc-compression do not compress WARC files with GZIP --no-warc-digests do not calculate SHA1 digests --no-warc-keep-log do not store the log file in a WARC record --warc-tempdir=DIRECTORY location for temporary files created by the WARC writer Recursive download: -r, --recursive specify recursive download -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite) --delete-after delete files locally after downloading them -k, --convert-links make links in downloaded HTML or CSS point to local files --convert-file-only convert the file part of the URLs only (usually known as the basename) --backups=N before writing file X, rotate up to N backup files -K, --backup-converted before converting file X, back up as X.orig -m, --mirror shortcut for -N -r -l inf --no-remove-listing -p, --page-requisites get all images, etc. needed to display HTML page --strict-comments turn on strict (SGML) handling of HTML comments Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions -R, --reject=LIST comma-separated list of rejected extensions --accept-regex=REGEX regex matching accepted URLs --reject-regex=REGEX regex matching rejected URLs --regex-type=TYPE regex type (posix) -D, --domains=LIST comma-separated list of accepted domains --exclude-domains=LIST comma-separated list of rejected domains --follow-ftp follow FTP links from HTML documents --follow-tags=LIST comma-separated list of followed HTML tags --ignore-tags=LIST comma-separated list of ignored HTML tags -H, --span-hosts go to foreign hosts when recursive -L, --relative follow relative links only -I, --include-directories=LIST list of allowed directories --trust-server-names use the name specified by the redirection URL's last component -X, --exclude-directories=LIST list of excluded directories -np, --no-parent don't ascend to the parent directory Mail bug reports and suggestions to ,@@l?.netrcmacdefaccountportdefaultmachineforce%s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name 0Xbarnoscroll%dm%s%ds%dh%s%dm%dd%s%dh%dd%3d%% %4.*f%s --.-KB/s in binarymegagigaInvalid dot style specification %s; leaving unchanged. %4.*f%c=%s=%ss %6sK %*s[ skipping %sK ], b/sKb/sMb/sGb/s B/sKB/sMB/sGB/s eta %s KMG333333?@Y@X@= ףp#@@Gz?A?Cannot get REALTIME clock frequency: %s eAMbP?SCHEME_HTTPSSCHEME_HTTPSCHEME_FTPSSCHEME_FTPSCHEME_INVALID%s %s %s %i %s %s %s %sBLACKLISTSUCCESSNOTHTTPSNONHTTPABSOLUTEDOMAINPARENTREGEXRULESSPANNEDHOSTROBOTSUNKNOWN%s REASON U_URL U_SCHEME U_HOST U_PORT U_PATH U_PARAMS U_QUERY U_FRAGMENT P_URL P_SCHEME P_HOST P_PORT P_PATH P_PARAMS P_QUERY P_FRAGMENT Removing %s since it should be rejected. d-X-p-|---------/robots.txtLoading robots.txt; please ignore errors. allowdisallowCannot open %s: %shttp_proxyhttps_proxyftps_proxyftp_proxy%s%s%dFailed to rename %s to %s: (%d) %s Giving up. Retrying. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. URL transformed to HTTPS due to an HSTS policy %d redirections exceeded. Failed to unlink %s: (%d) %s %.*f %s1.2.4b/sB/s@@ffffff?Found no broken links. Found %d broken link. Found %d broken links. *password*%2E%2Eindex.htmlUTF-8Conversion from %s to %s isn't supported Incomplete or invalid multibyte sequence encountered Unhandled errno %d The name is too long, %lu chars total. Trying to shorten... New name is %s. Unconvertable multibyte sequence encountered Failed to unlink %s (%d): %s httpsHTTPS support not compiled inUnsupported scheme %s@/?#;:/0123456789ftp://%shttp://%shttphttp://https://ftp://ftpsftps://No errorScheme missingInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address : <> WARC-IP-Address.cdx CDX a b a m s k r M V g u sha1:WARC-Block-DigestWARC-Payload-Digest wb+%Y-%m-%dT%H:%M:%SZwarcwarc.gz%s-meta.%s%s-%05d.%s%s.%sOpening WARC file %s. Error opening WARC file %s. WARC-Typewarcinfoapplication/warc-fieldsWARC-DateWARC-Record-IDWARC-Filenamesoftware: Wget/%s (%s) format: WARC File Format 1.0 conformsTo: http://bibnum.bnf.fr/WARC/WARC_ISO_28500_version1_latestdraft.pdf offclassicrobots: %s wget-arguments: %s Error writing warcinfo record to WARC file. wb9Error opening GZIP stream to WARC file. WARC/1.0 CDXCDX file does not list original urls. (Missing column 'a'.) CDX file does not list checksums. (Missing column 'k'.) CDX file does not list record ids. (Missing column 'u'.) Loaded %d record from CDX. Loaded %d records from CDX. Could not read CDX file %s for deduplication. Could not open temporary WARC manifest file. Could not open temporary WARC log file. Could not open WARC file. Could not open CDX file for output. application/octet-streamWARC-Warcinfo-IDWARC-Concurrent-ToWARC-Target-URImetadataresourcemetadata://gnu.org/software/wget/warc/MANIFEST.txttext/plainCould not open temporary WARC file. metadata://gnu.org/software/wget/warc/wget_arguments.txtmetadata://gnu.org/software/wget/warc/wget.logrevisitWARC-Refers-ToWARC-Profilehttp://netpreserve.org/warc/1.0/revisit/identical-payload-digestWARC-Truncatedlengthapplication/http;msgtype=responseresponse%s %s %s %s %d %s %s - %s %s %s Found exact match in CDX file. Saving revisit record to WARC. requestapplication/http;msgtype=requestuser.xdg.origin.urluser.xdg.referrer.url%02x%.*f%c%.0f%.1f%.1g%.3fError while matching %s: %d Invalid regular expression %s, %s pathconfsha256//;sha256//Skipping key with wrong size (%d/%d): %s -----BEGIN PUBLIC KEY----- -----END PUBLIC KEY-----*?[]htmlhtmFailed to open file %s, reason :%s Failed to stat file %s, error: %s Trying to open file %s but it changed since last check. Security check failed.Failed to Fopen file %s Failed to get FD for file %s Failed to stat file %s, (check permissions) File %s changed since the last check. Security check failed.Failed to unlink symlink %s: %s utime(%s): %s forkContinuing in background, pid %d. Output will be written to %s. /dev/null%Y-%m-%d %H:%M:%S%H:%M:%S%s: %s: Failed to allocate enough memory; memory exhausted. aprintf>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/KMGTPEP?fffff#@Mb@?A888888<8<8$8$8484848488484848<8T8T8T8,848,8p8<848848<8<8<848<8<888T8484848$8<8T8<88T8<8T8,8-cares+digest-gpgme+https+ipv6-iri+large-file-metalink+nls+ntlm+opie-psl+ssl/openssl1.19.2mipsel-unknown-linux-gnu-gcc -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -march=mips32 -msoft-float -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib/ -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -march=mips32 -msoft-float -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib/ -DHAVE_CONFIG_H -DSYSTEM_WGETRC="/usr/local/etc/wgetrc" -DLOCALEDIR="/usr/local/share/locale" -I. -I../lib -I../lib -DHAVE_LIBSSL -DNDEBUG -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE mipsel-unknown-linux-gnu-gcc -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -march=mips32 -msoft-float -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib/ -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -march=mips32 -msoft-float -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib/ -DHAVE_LIBSSL -DNDEBUG -mel -mabi=32 -march=mips32 -msoft-float -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -march=mips32 -msoft-float -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_old_softfpu_1.0.2/lib/ -lssl -lcrypto -lz ftp-opie.o openssl.o http-ntlm.o ../lib/libgnu.a -lrt ERRORWARNING%s: No certificate presented by %s. %s: cannot verify %s's certificate, issued by %s: Unable to locally verify the issuer's authority. Self-signed certificate encountered. Issued certificate not yet valid. Issued certificate has expired. %s %s: no certificate subject alternative name matches requested host name %s. %s: certificate common name %s doesn't match requested host name %s. %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). openssl.cThe public key does not match pinned public key! To connect to %s insecurely, use `--no-check-certificate'. OpenSSL: %s WARNING: Could not save SSL session data for socket %d Could not seed PRNG; consider using --random-file. OpenSSL: unimplemented 'secure-protocol' option value %d HIGH:MEDIUM:!RC4:!SRP:!PSK:!RSA:!aNULL@STRENGTHAABBBBBBBAAAQRQQQQQNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sNTLM NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cYYhZt]YKGS!@#$% ABCDEFGHIJKLMNOPQRSTUVWXYZ234567’‘GB18030e'`literalshellshell-alwaysshell-escapeshell-escape-alwaysc-maybeescapelocaleclocale|T, TMPDIR/tmp/%.*sXXXXXXmemory exhaustedPOSIXLY_CORRECT%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '%s' is ambiguous %s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument /dev/ttyw+;Zx0Nm<[y1On UUTUUUTTSSTUUU UllP$upperloweralphaalnumcntrlspacedigitprintblankgraphpunctxdigit_|PD  h`<<p@,Hex-QlSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [, [^, [:, [., or [=Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \)Unknown error %dPOSIXCHARSETALIASDIR/usr/local/libcharset.alias%50s %50sASCIIA=A;H\l |  E$0EPFFFFFF F SGSG UG$UG(UG,UG0UG4UG8UG