ELF @4\P4 (44@4@44@4@ @@HH(Hp@@DD@D@DDPtd``G`G/lib/ld.so.1GNU GNUU0ej(LVGI `@ `E@;@@  p0I@Ippp@ pepvp%pao`@oo[@ v.'ac@_%]Hug=\KK{[/nX8 e>58SQl]2/s@Zt 4WJOG*KhPxBqfLaJd6Nj\Rs=^3nMbYkp'Bihje]0T19rEZ  0(q) kX+i35!5Fc (E"cz)I#}r,_&B8Y0W)V*bnz#$2 RsAdZup9<w@r `UV/?&6QjDmQo PSvYE>hbe_g(tT+$:4H7^P=OH^#[NIgla[-N:MX ;*~USFy?!flAM,LkU `ofR;v6w+ |;A{ !FC7 DdC~yt :?J-x <uD|4mi>1m-q.T\LW&9. V},`1 $<Gp7G"%2O'o3C"I%mD\ . ,wC4 Ct E  UA  (@ `8B` HeqCx pCH |D 4BP  pmC GA bA p@ )x@` rThI*XFB, CT V CL RA HA (4A p@  @ p1B xD Ap "A DT \B X(I C lB B dzC ,xC E C G i 4I7hA  E$ %D$ $ICl `>Cd E@C pE$ ?0vC &C\ d@  D u @T R <IPA  E$ B (Ap C E@ o ~A H88pB XA A` A QlINH{A4 C C LC 8C hC E7ت@` B  BHLlD` D,Ie C C C !\A 4B bLE Ct & |C 5lC @ (@H #C :@ 0IPE$ ,PIE (A p@  C@ HBl 0E E8 AA h@ XB #VA /A  C >Cd r-C _PE Y 8I; C  ] A sTI C (4C 8AH B C| ~ E C pC y CP [XI iCX l@ `C4 DD D T@  D@ 0@D8 dC  yB  D  DPE8 NHA  $Ch  C  E B 6,A ED - C .h@$ f$D pD BA )xbCH `IRA   nC lC8 q0]A `WA #,I B$ d+A  LB  E E BH CT6 }C $B X C  tiC |-DH o,zB (D  tC aHI;a@ e4B C deC aD@ k{AH C, DBT V HzCX LI14C A jCl uC| $}Ch AL 4Ad  [C pE ydmC  @ hI Cl @aC@ < C Y C$ %@ |{A` o "CH 0I D %@ 0C C HH@` C ?|A  E0 `CH ~8B  JA H@ 8ȁB` A p\B$ DT D $ qAP w@ TA P:A  E 9 C LA K ̤A  (Ii(?C0 hDL LKC C {C (B F H@ m`@ $D\ |uC A @D( Cd @mI0hyC (+D  PA mB hB Bt (A < E  08@ @E* 0E EEEx EaED EE.ESE]E[EpE0`E PE@E 0E' E0EEBEEE E'EEE>EpE`EKPE^ n@E 0E EQE EEE EfE>EEo EE@pE`EZPEg @E0Ex  EGEEEEEEEjE8E{E2 pE`EPPE @E0Em E]EE,EEEbE EIEE6E[pE`EgPER @E0E" EEEKE/E7E0E EKEE EpE`EPES@E0E EEEHEeE\EgEEEEG EIpE`EPE@EL 0E! E )EaEE^E!EzEEE EJE&pE`E PE@E0Ey E EE EE3"5E EyEEJEEpE`EPE @E 0E EEmEs EEZEEEEUE:EpE`EePEi @E0E# ElEXEEE%EEnEEEEpE`E4PE@E 0E E EErEEE7EFE2 EEUEpE` `ETPEz@Er0E EEEmE E_E7EE8EEEpE`ElPE@E@0EG EEFEEqEEEZEE E=EpE1`E PE@E0E E EE 8EEEw EE< EO EE EApEb`EB PE@E*0E EWENEuEEEEE0EEn EUpES`EGPE@E;0E EEEEEE__libc_csu_init__libc_csu_fini__libc_start_main__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable_Jv_RegisterClassesmemsetabortmemcpygetsocknamegetpeernamedcgettextlogprintfexit__fixdfsi__floatsidf__subdf3__muldf3select__errno_location__nedf2accept__eqdf2xmallochash_table_newhash_table_puthash_table_getrecvrpl_strerrorhash_table_removeprint_addressstrcmpescnonprint_urisocketsetsockoptlookup_hostexec_namequoteaddress_list_address_ataddress_list_releasebindrun_with_timeoutaddress_list_get_boundsaddress_list_set_connectedaddress_list_set_faultyaddress_list_connected_plistenstrlenstrcpymake_string_hash_tablestring_set_containsrenamestring_set_add_IO_putcfputsfwritenumdigitdl_url_file_maphash_table_get_pairhash_table_containshash_table_for_eachxstrdupdownloaded_html_setdownloaded_css_sethash_table_destroystring_set_freehash_table_iteratehash_table_iter_nextstrpbrkhash_table_countstring_set_to_arrayget_urls_css_fileget_urls_htmlurl_parsedummy_iriurl_freewget_read_filelogputsunlinkfopen64wget_read_file_freefclosexstrndupstrrchruri_mergefree_urlposptimer_newptimer_measureprint_decimalptimer_destroystrncmpxcallocextract_paramstrdupdelimc_strncasecmpquotearg_stylehttp_atotmsscanf__adddf3make_nocase_string_hash_tablematch_tailstrchrqsortgetlinememcmprpl_memchr__ltdf2datetime_strfputcferrornumber_to_static_stringhuman_readableftp_authssl_connect_wgetfd_closessl_check_certificateftp_greetingsearch_netrcssl_initscheme_disableconnect_to_hostconcat_stringsftp_loginftp_pbszftp_protftp_systftp_pwdftp_process_typeftp_typeftp_cwdftp_sizesocket_ip_addressftp_pasvftp_epsvftp_lpsvconnect_to_ipretryable_socket_connect_errorftp_portftp_eprtftp_lprtftp_restftp_retrftp_listoutput_streamaccept_connectionmkalldirsrotate_backupsfopen_exclfile_exists_pfd_read_bodyretr_ratetotal_download_timeset_file_metadatafd_errstrftp_responsestrtollurl_file_nameremove_linksleep_between_retrievalswarc_tempfileurl_stringprintwhatdownloaded_filewarc_write_resource_recordtotal_downloaded_bytesnumurlsinput_file_urlfile_mergeftp_parse_lsacceptablestrstrposix_fnmatchfnmatch_nocaseaccdirurl_set_dirurl_set_filelstat64readlinksymlinkset_local_filechmodtouchftp_indexhas_wildcards_pyytextstderrstdinstdoutyyleng_IO_getcfreadclearerr__ctype_b_locyy_scan_bytesyylexappend_urlyy_delete_bufferfd_read_linefd_writeskey_responsebind_localstrtokc_strcasecmplocaltimerpl_mktimefgetcatoichar_propstrcatstrncatstrptimeurl_escapehtml_quote_stringurl_escape_unsafe_and_reservedfflush__divdf3getaddrinfoinet_ntopgai_strerrorfreeaddrinfostable_sortxstrdup_loweris_valid_ip_addressfilenoflockfseekftruncate64fopen_statfstat64xreallocget_urls_cssurl_has_schemestrcspnstrspnmap_html_tagsrewrite_shorthand_urlurl_errorinform_exit_statuswget_base64_encodefd_readstrtolwarc_write_response_recordmemrchrmd5_init_ctxmd5_process_bytesmd5_finish_ctxrandom_numberurl_full_pathntlm_inputntlm_outputsetlocalerpl_timegmgmtimeaprintfversion_stringscheme_default_portfile_sizecookie_headeraddress_list_containstest_socket_openfd_read_hunkftello64feofsocket_familymemmovewarc_timestampwarc_uuid_strwarc_write_request_recordcookie_handle_set_cookieunique_nameurl_unescapehsts_storehsts_store_entryfdopencookie_jar_newcookie_jar_loadhas_html_suffix_pnonexisting_urlcookie_jar_savefree_vecvec_append__fixdfdivalid_progress_implementation_psepstringmerge_vecsgetuidgetpwuidwarc_closelog_closeisattyunique_createtcgetpgrpvfprintfvsnprintfredirect_outputprogress_schedule_redirectsignalhome_dircompiled_featureswgetrc_env_file_namewgetrc_user_file_namecompilation_stringlink_stringpipeposix_spawn_file_actions_initposix_spawn_file_actions_adddup2posix_spawnpxmemdup0program_namebindtextdomainbase_nameprogram_argstringdefaultsrpl_getopt_longrpl_optargrun_wgetrcrpl_opterrinitializerpl_optindsetoptvalrun_commandcompile_posix_regexmatch_posix_regexgnu_getpassfork_to_backgroundset_progress_implementationlog_initwarc_initoutput_stream_regularperrorprogress_handle_sigwinchhsts_store_openscheme_leading_stringurl_schemeurl_uses_proxyretrieve_treeretrieve_urlretrieve_from_fileprint_broken_linkssave_cookieshsts_store_has_changedhsts_store_savehsts_store_closecleanupconvert_all_linksget_exit_status__gedf2is_basic_tablerpl_mbrtowcmbsinitwcwidthiswcntrlmbtowc__floatdidf__gtdf2calc_ratelog_set_save_contextdetermine_screen_width__divdi3__moddi3log_set_flushclock_gettimesysconfclock_getresschemes_are_similar_paccept_domainsubdir_paccept_urlres_get_specsres_retrieve_fileres_parse_from_fileres_parseres_register_specsres_match_pathregister_delete_filenumber_to_stringare_urls_equalsufmatchfd_peekinflateInit2_progress_createprogress_interactive_pptimer_readinflateprogress_finishinflateEndxsleepprogress_updateptimer_resolutionconvert_to_bitshsts_matchhttp_loopftp_loopregister_downloadregister_redirectionregister_htmlregister_css__ledf2random_floaturl_valid_schemeget_urls_fileis_robots_txt_urldcngettextmake_directoryiconv_opennl_langinfoiconviconv_closeget_max_lengthfile_non_directory_pis_valid_ipv6_addresssha1_init_ctxsha1_process_blocksha1_process_bytessha1_finish_ctxgzwritegzclosefseeko64base32_encoderewindstrftimepath_searchmkostemp64gzdopenstrtok_rbase32_decode_alloc_ctxlog_set_warc_log_fpsha1_streamfsetxattrsiglongjmpvasprintfutimegroup_membermkdirforksetsidfreopen64rpl_ioctlgetpidsrandom__sigsetjmpsetitimer__fixunsdfsiusleeprpl_regcomprpl_regerrorrpl_regexecpathconfsha256_bufferERR_get_errorERR_error_stringSSL_shutdownSSL_freeSSL_writeSSL_get_errorSSL_readSSL_connectxmemdupSSL_pendingselect_fdSSL_peekOPENSSL_configRAND_statusRAND_file_nameRAND_load_fileRAND_egdOPENSSL_load_builtin_modulesCONF_modules_load_fileSSL_library_initSSL_load_error_stringsOPENSSL_add_all_algorithms_noconfSSLv3_client_methodSSLv23_client_methodTLSv1_client_methodTLSv1_1_client_methodTLSv1_2_client_methodSSL_CTX_newSSL_CTX_ctrlSSL_CTX_set_default_verify_pathsSSL_CTX_set_cipher_listSSL_CTX_load_verify_locationsSSL_CTX_get_cert_storeX509_LOOKUP_fileX509_STORE_add_lookupX509_load_crl_fileX509_STORE_set_flagsSSL_CTX_set_verifySSL_CTX_use_certificate_fileSSL_CTX_use_PrivateKey_fileSSL_CTX_freeSSL_newfd_transport_contextSSL_set_fdSSL_ctrlSSL_set_sessionSSL_set_connect_stateSSL_stateSSL_get_sessionfd_register_transportSSL_get_peer_certificateSSL_get_verify_resultX509_get_issuer_nameBIO_s_memBIO_newX509_NAME_print_exBIO_number_writtenBIO_readBIO_freequotearg_n_stylequote_nX509_verify_cert_error_stringX509_get_ext_d2ia2i_IPADDRESSsk_numsk_valueASN1_STRING_cmpsk_pop_freeASN1_STRING_to_UTF8ASN1_STRING_lengthCRYPTO_freeGENERAL_NAME_freeASN1_OCTET_STRING_freeX509_get_subject_nameX509_NAME_get_text_by_NIDX509_NAME_get_index_by_NIDX509_NAME_get_entryX509_NAME_ENTRY_get_datai2d_X509_PUBKEYCRYPTO_mallocwg_pin_peer_pubkeyX509_freeDES_set_odd_parityDES_set_keyDES_ecb_encryptMD4_InitMD4_UpdateMD4_Finalwget_base64_decodefread_unlockedferror_unlockedfeof_unlockedlast_componentbase_lenlocale_charset__ctype_get_mb_cur_maxiswprintxalloc_diesecure_getenvexit_failurewcslenwmempcpywcscattowlowerwmemchriswctype__ctype_tolower_locmbsrtowcsrpl_getopt_internal_getopt_internal_r__fsetlockingtcgetattrtcsetattrfputs_unlockedfflush_unlockedputc_unlockedhard_localetzsetlocaltime_r__ctype_toupper_loctowupperwcrtombtouppertoloweriswalnumrpl_re_syntax_optionsgmtime_rmktime_internalgetc_unlockedungetcfscanflibssl.so.1.0.0_DYNAMIC_LINKING__RLD_MAPlibcrypto.so.1.0.0libz.so.1__ashldi3__lshrdi3libc.so.6_IO_stdin_used__environ__xstat64__fxstat64__lxstat64_ftext_fdata/mnt/new2/sysroots/mipsel_softfpu_1.0.2/libGLIBC_2.15GLIBC_2.7GLIBC_2.17GLIBC_2.2GLIBC_2.3GLIBC_2.0uii ii ii ii  <<-'!'܇@܇ J<0'$9' J<0'(9'  'J<0','I<eI@!  !(`@!E #PdsqB$)s&`!`Cb`C/c8+#CD/$WPCF$ $#$3$2$"$q$u$o$-P`'( Pd"Tedtuvgf~+c$ P<8P<8}+edhiz+j! lwgf~+c$yqrf~+c$c$Q+&<840,($ @'J<'0'̆!F< !$X$ !܏=@!  @!bB$܏#4'H!%$2$5 $; $3$B $? $F $#$#"`P@e&o(nTCEG+F jPE l+CEG+IFK+B$QCEF+MB$+1&< +!+ !$ ('[J<'0'肙h!Hld`\XTPL4Ư8ů !(¯8@܏B$#'삙0ï!  !(`܏$$Ï(ď*d&@I<0Ï!bR !(@!(@@܏8Ï`! @ +,܏􂙏!0 !8܏Ԃ4!@!@$$,ԈB0@$\,@D!( $!@@܏ E @܏}$ #< ! @܏X,B0@P` ! ܏1,F/ !8+܏!v2Rr21&U<&UUc$+C@ $rD! @ (¯ '܏!@!!0į!C`, 'Ə! `!(!8>/ 8ï܏@8Ï $ r!(d8ï 4ů4ŏ܏ 8Ï&2cR&S8(ACPh"@HH<C,$C! >! X9 $HhB@T! `F$H<,$V!  $8܏F<Ԉ$! T$8܏!(@ $8܏@ ď$<!  $F<8܏! ;$HhB@T! `FH<C,$|C $CT!  $8܏F<Ԉ\$$ ! 8܏!@@  $8܏䀙 D8܏$P!( !0@8܏@ ! A!hB@ÏFCHH! 0= $H $`4C`T/blC `T/b$C`T/bB@T/b,:@\/b-@F<|$ !(&@8܏ $!A8܏@ $8܏D䀙 /$8܏G@$ $!@E@8܏@ C$!b8܏@ $8܏D䀙 $8܏G7 ,!@$0܏$B$DB4B&6D,<F<$!B@ $BVF<$ $$0܏*@F<$ H$%D0܏| ! $ B0܏D $0܏0ď0$ !(!@0܏D$ďŽ| Žď | ! D0܏  ! 0܏! @ !!@H@0܏ŏϏ# +(#W #(0܏!@$ !( B0@0܏@ $0܏H&@T4B@ԈE-$TF<B@TF@s&3B$ E#!CB@!B B0@c$#B$@M,"!D!bc@!c c0`$M!Bc'$d"$dT$B$"B$$,( ! D$ 0',($ !0''J<0',!HD@<40(! L8! !(!@0',!$ ' a@>W$$B !T $C$QCTBD!$ E$'M !0!@C@XNDc$$$ ŏ(!0$! @$ !@$!8࠸!  !8 @D04D~N! CTB!$B'!0M @! @!8  $@$D04D! `D B N! ! LHD@<840,(P'J<0''840<! !!@@@ 䀙 DGPD ! @.O !(!@$  2$bD $>PD D!@<840,H'J<'0'pL'xt(|!!0!( !@(P $ăd!  d'"@(QdRXSPC00'B0G<+$! $  GC 2$b! D zT$ ($ @E$c0^c,`! DT! FC$! mTD B$!( $ $d$+H Hp!`CfDC)$bP%!  zT$ ! zT$c$b!($fTC40,(8''J<8!G<0'$+$$'<4N %! @ !@F<d eH! !( !0@! AD T,$ ! .O '$ C 2$D T $ ((<84@''J<8!G<0'<4N +$! @ !@F<d eH! !( !0@! AD T,$ ! .O '$C 5$eD T $2$e T$ ((<84@'J<0''Ȁ!(<84! ! GU,$ ! .O '$ C 3$D >U$ ((<84@''J<8!G<0'<4N +$! @ !@F<d eH! !( !0@! AD U,$ ! .O '$C 5$eD U $1$e U$ ((<84@''J$&$TP $P1&"|bTCTsb1&B#"s`Vb LԈG$&R+R{`P&$[d(Ad(mc$g+c$+Co`P&$llT&$+ R<$Ph&R+R`P&[d(Ad(c$g+c$+C`P& ~T&oT&+ R&$h&&R+RD`P&$[d(Ad(6c$ h+c$+C8`P&$5oT&$2nT&$/wT&$+ R'$P&& h R+R"`P&$[d(Ad(c$-h+c$+C`P&$u$dT&$nT&$ lT&$+ Rh"$Dh&$M $CT V!$cg!$"#(%!@$*`Nh@RR# "B@PDh`"! !@*D`]h@BR$ "@D`$ !(@"zh ! @%(& ! @"$ "2$"(!(!0 ! "!"6!@&*`h@R# "@D$` !(h" ! %(& ! @"$ "0#"d$!Cs2$&`@"$!T @C$+ E$ h&$$+ D$ c$!*B$`k%g$B$!*`k%g$Eh!0@<840,($ @'#$'#&J<0'$ !#'(!!0 ! `܏!P!  !(@!$ +('J<'0' $!@!!! D .i Œ$ @ ('P  @T@D ! $ ('J<'0'tplhd`\XTP''$!!d0 $$$ d4,@! <$ #0v!@@V$+@!$CT/$"38@&+S5@-$2C/b-$&-$>$&+(SPET!@T!@T!@#j&+(SEETB$B$SEPB$!@iB$!@EB$#j B!8&G $/ $"$'$ $ $$!$js$ ,(!(`U!jbOP $#E(LQPbE(E$+(FPbiD0BRPbiD0F$.D(PP $iD0?JP!=KP!D0$^,9$,6L$#jFP$E$0^,P$NP$JP$KP$LTbi$!8@c$bi $GTbi $b$ic$FT$b lc$FP$bic$b $ic$FT$blc$7jC!&+SU@$0j$$!@/$0C$^c,`B$!Zi!B,@&+@Tj<$$ă$G, $F$E@'+@Tăj? $$ <$!(@h !0$@8'!(@!0f $8'<<$$Ń$G,4P/$F$D0@/$'+@TŃ@D 4 `D 'i ''ltD $@j @ D@RU_j@T“'+@<$$ă$G, P$F$E@$'Wăj$ <$“<$B0(D!/$%0D$^,B$0$ $"D7&MT1&k! F G1&+3@T"jk$D7&Zi! +@ yk@< $$$<$"D$, Q$G $ P$GM!  !psk$F1&+3@T"ji$i$i$@Zi!`tplhd`\XTPx''J<0'(0,$ 4!!!!$*@r Qx!Q$ !(@`VpVl"Dl&!40,($ 8''J<0' IR$ "$+@Tƒ!(@p$B$D,!(@C$T @P$p'B$D,C$T@$+@TW ! !@4D  !(! D !@!$ ! !@@D ! !@!  '!0 !8!@"@! D  G<Ԉ! 2$$ !@!(@P!0!8$ D ! D ! H $qD $\  $^q®!@!@p!@ ! `!LHD@<840,(P'G< $!3$B$!fc$Cc0!fcGC 'J< 0'$ D! $D ! $ ('('J<0'L!! ! ܏C$!@4nB#'@'(! !( !0@܏F<(! 2$ $܏! 8 !(` @܏8L !(`@܏L R!< ! TPTÏX`\`$Q!$''J<0' I67 e>&! $$(! !0@ !@0!i4q$j(,"r$ $" $"F< CBH& ! !(` !0!@AԈG<3$$ ! ! L !@! P!( !0@r h!0! `$ !8&P$ PD ! `\! XTPLHD@<8`'J<0''40,!($ ! !܏! @ !@!&܏#'Gv$B$F, E$C@&+@T !(B!0 $ !('J<'0'$<840,($ N!K`! !! !!@*$ C!:$Q; $P#0*4@P&!B0WT&! !( !0(@&A@܏ ! @܏ ! @@܏ƏPH!ď, @<ԈG@܏%B,@Tȏ3$,$҇ ,$ Ԉ @ԈB4dԈG  xG"$$*4Ï!+P!s!S*Sd`TI<STԈ+R^@I<ԈG'$@ ! @܏$Q$ VhÏpTh$$ $bŏ!+p! !D 4Œ@B0@PԈG UԈT L@܏4pb@PX L@܏%C@4F!TC!2T!C $c$+,`T!B$!0!8 $ $D$+(#T/$B$ (0q?!(!+ d!(!0`܋!8gB$+`T!!! $ $E$+@e U*CB$@HDq'!Hi!+(h! $! @T#T!+ `#!T!*@T!#g+#+ #(P$# +!D¯%06G$G<$6G$L$ǯ .$!@@܏@$Ǐ! `!(,ï $ǯ@܏,Ï@$ǏÈ`@#!D ď@܏D ! @܏D ď';q t '!T!@PLHD@<840X'J<'0'P4dT+tplh`\X !|D -$b<`!<  b@I<9B@Td  9B I<9b@Th 9D$ 9b@'l  @ ԈG$Ԉ $ $P !(@m H$$ !  !@ @ !@ 䀙 D $P!(@!0  !8@ jb@$ԈG$ $ P$ !(@ "B0r@@!x!  $ G$!0@ !@ "B0@PH B$B,S@T$H@ @`x!  $ !@ ! ` G<Ԉ! >$ $ $P !(@ H`Ԉb@H! ` LH fDL! ` ,$@ C$ԈG<$! 49$ $!@  P$!(@!0 !8  H$ $ $ !(@+ | !@$  ԈG$ $ ! !(@ "<B0$ b<SlP@PHJ@H@$F(*W0@ԈDbPG< G<$CT$G<0?$$ !  !@ ! P!( !0@X $! p?$ Ȁ$ !@ ! P!(@ !0@v G@t*B<@TR&%$$bj@D@D D `<  D  D  D  D  D  D  D !`| ! @ $GPBD$C:@PB\R&d!"$d! ! ܏$<$$"$\$B@$i, f$e``!&"&C,`H< V!H$ C&B#cd!! ` $ !0!W]$ u$b@8ŽC`&*C`P#өB$B$![$&!F$G$ $> $= $< $fbgTc$*(w$*$ b&!]$&8ŽL0B$$$!  8®! @j !@ $#d! !0  $ !TG2!+~!%CЂ! `( !(D(Ԉ!@H<$ D$! $(Ȁ! `!( ((G@ !@@  ! @h! $ !0@腙! h' $ïDx!  !@% !@@ @ ! h! $ !0@D ! !U*D`xT+!pt#C+P##C* bT!C+@!B@4 d$e!0 !8@ ! l! @ !(`!(`!`H<(f,g! @ t$u !@! @$!(`!0 !8@l! !(!0 !8! @!(`!0!8!@ !`A@ C$d!0  !@ A@ C$Pb!M*@؁4Xb\c%C@؁ !  ! pt!pß+ Cp!|!@t$ 'X'4$`'|h,0 ' !($uV$rD$vDX'@  $CU$t*@4 dp+e@4U*$ C @ ! ! @!0@ !8` tpt#@$!|$ !  p ! |@ć  ' @!@ $$CD | `pbc! Et+!e!Cdb X\!C! +b !Dh؁qp4@ C$0| #8A&U$U 0m@|׽`'X' !8A$&C$U b"@4x#p+b##cx%S@ !@]@  ! @h! `$ !0@D ! `4X\%C@ ! I܃!0@!8`!  !(! !( !0@!8`!@ !`A܃$! !( !0B!8$! !( !0@!8` !@!`4!! 0,($ 8''('J<0'<84  ! @!@H<\G$XF!(` !` A!8H<$dG`F!  !( B($$ 8b4(B@I<B$I&!  ]$!@{@䄙!  !(@w@&!  8 @8$!  !(!@!@! !Bd:$Tdf$! & 88!@ $ $<+ @Pd€B$+@MU$d/$ T(c$! `& !@( ! Ў2@&d;$ T,v$!  !(!@,!&,!2@P0d?$ T0w$!(!  8!@08!$!2 R4d#$T4p$!  !(4! R$1&! :$ #04T @$!( D$ 8! @ $8!`!  !( ! @ !@(!\$ 0$I! !( !@$ ( #,&" (4! @!(" !@%! !.$/$,+02P&N&P+0+0 'S&ƃT'N&P&' W+0'&O+0!Ƞ'&"ãW#! `8 /$!@ @8!j!!@!P`! !H`섙 @ 5@D ! $̇`h d`h@d%! 4' hAh! `!H*I@#2! +`P!H#+(#(E!+p#(!(E( ! #( '% @! !( '@*U@T#􄙏+@P#+#u#b!+0!S!*!( (0! ' #(􄙏 '@􄙏 'D ! !|xtp'J<0'4'$R,( ! ! @C$܏#'(! !(@!0@ !@܏H<(! 0$ $܏Gr$!! !  +t@hI&&H>qP^q!#+p@rl!HSr! !S, !(,@(&! !( &! !( !0R&! !+"@!! 7!(W(,(! !(e !0R&(,G&&pr!h+p @!(! !(! !(e !0&!$!0!((! e !(h1&+q@!TPLHD@<840X'J<0'' ($(' !@ ȇIf^&>f ^ XP`h&@$'H<,0\dl| (48@HTXptx$`$ ɯ!  !8!@B$B,܏'& ɏC@$ʏ(!(@('!0  ɯ܏ ɏ(! )!( !0.@܏(! 0' $. @܏(! 6' $0&]܏!!£$&TT! !( УB$#' !0܏HBì QC!@c$A%bB$=$ HTB0)Tì&Eì$!B Bì!@ BìQ!@ c$I %@" %bB$=$HPìB0!BCì! Qìc$!(@!%DbB$ì$H <'J% $!H@!`@ $$$$$$efP!jc_à@$@!!c0!#cSà@=$Bc0!lcJà @=$$A@!!c0!#c;à @=$B$@(@!!c0!#c,à@=$c0!#c#à @=$B$(@!B!c0!#cà$@=$c0!#c$ à@P!(@B$$ b:!(@T''@pJ<B80'+LHD\XTP<!!!l, !l'$'($ $ @# !`#P~!P! @!(l''0 ,0 @,' `V 1!!@K! W !&s&!@`V!# Kl!Dl$!PVP@!Pc*`+^!  $ $@P&!P%$DT+^@TJ%C$!vD&`b.@!  !(` V!! !(`l'' 0@0#!B\#DBXb.TPLHD@<8`'C$J<'0'8!! C40(,< ! P(@,m$ '! @ !8@@D (m(  #<840@'!$C$+ F$ G0f$+0 i$ &f0c0B0#C$$c0!$ $! ␿C$+# F$ H0f$+0& j$ Ff0c0B0#CQc0$$c0Eg<#B$ T %P^*!($#&!(-%(!H'!(E&P&PI!(BR-%(( <~J%!P!(!C&P'&PE!jQ%j <'J%!P!e!8G&P&PC!8RB=%8 <0J%!P !8!HI&Pe&PG!H*T L %H* <J%!P!H'!(E&P&PI!P%8e0*%(c0%B$@ $J! !U@%C&$r&t !!C(%e!!T&d$V&D@k%!@)–%(%!(m! &($(E!&(!(>@!% ! (%E!(M!&(V$(&(!(e>@%g!(%E!(-!&(B8$('% &(!8 !®!@)&8%($8!(&8!8G®@%U!8%g ¦!!2&d$%&$!Q@$%T!2/%(!m! $&$"&#! ¦@%4! %D(&E!$&!c!t¦@%t!s%C,0!m!(&B$&!¦@)%(!(%4!!&2$&!T¦@%T!4%t!!&q$&!U®@8%U!/%(!!&$&!5®@<%5!%T!-!&E$&!u®@@%u!%T!!(&B$&!®@)%(D!(%4!!&2$&!U&p®@%U&!&%t@‡%! !&q$&!T®@&`L%U&`!&`/%(@ g %`!!&$&!4®D@&X+%5&X~!&Xv%T@ _ %Xt!m!&E$r&e!@®%!u%S4&P &PS&PP@ W %PS!M!&(B$(&8!(&H@¦%t&H6!&H,(%%@( O %H%!(.!&(2&(!(Ež@%S!(%$¶&@&@&@ @(G%@!(!&(&(!(E&8@%V&8!&8(%@(?%8!(!&(&(!(%¶@$%6!D(%E&(s&(&(@/%(!!u&T&r!& ¶@%& !u& %S@'% !!t&B&q!¶@%!t%34&c&l&g@%s!n!b&2&U!v¶@%v8!S%&&K&E@%V!N!&&!^@%^!%4&6&&@%!!&H&!>@%>8!%v&&&@·%L!!&t&!@%!%VD&&&(&"@%!!&S&!@%!%6H&&@%6!.!&2&!v¾@%w!%D&p&L&&@¿%P&!&!!V@¶%&!W&%@¿%!!&&¶!0&`L@%&`!0&`%p· @ %!`!&`t&`†!@a%`!`%L&X+P&Xb&Xl@` ‡ % !X!t&XS&Xqf!@Y%Xl!X%+H&P &PK&PW@X g %`!P!S&P2&PU^!j@Q%PK!jP%L&H&H*&H6@P O %H*T!H.!2&H&H4V!I&@@I%H*&@!I&@H%@HG%@ X!@!&@&@N!(&8@A%@ &8!(&8@%hO@@%H(!8.!&8t&8F!@9%8!P8%G&(eT&(&(@8/%(\!(!&(S&(>X!& D@)%(& !& (%%?@(%8! H!@)&%(% !e$ $(&C% &v!d&i %/@ %(!% !r$ $% !D@&L%d!C%&b\&P&C@%C`!O!Q@%b%t!#$U$t%C!"%b&&L&G@%CH%S!O!U$t$S%b!@%C!T%B&+&D&E@%CP!OL!t@X`%C&%2!$S$2&&%T%"@%!t!%!S$r$%bd!bH@ž&%s&)!S&>%@%"! o!@&h% D%! D$q$%r!\&L&$&(%@%"!/% t$ !q$t%d& !#@& & %C%b@'% !#!@P!@!F%@%S!$T$@S%@H!@h&&&@ ¯%%B%r!P!PT$S$r%T&@T!T% D! `&X0&Xt&Xy%b@ _ %XbX!o@&P!¶%V&P^%P!v$R$&P^%V%@ W %PB%@!`O!v!`$@$%@F%H@'% L&1&&@@¿%!!B!@A!#ŽX%\%@!q$@$d%&@&@!q&@ %@G%@!%`V!p$`$V%!@ah†%&`&`!p&`%C@ g %`!@! D–%r%"! $v$"%rO%H#\!&&9&7@%#!/% $ !v$ %!&@%d`!&P&&%@%!@!¦H%t%P!T$i$P%t&e&u!T&l'% @%bT%(!o!Hi$($%!#@N%HI!Hi`L%b&&K&Q@(%E!8O!@) > %8%(!8$($%!dX%&&J&^@(%E!O%(4!D$($ 4H% @ž! D%S!h O %H"T&&W&E@ %D!X!&4L&p!@¶%V!v&'X&h&g%B@%b!x!T&I& S!@!¦%!T%bhPH&D& &@‡%!!HIL&r&ȹ& V&1!$&'@!N%H@ !HI%$%!8!R&& T!D@! – %!R%P& b& & @'% !8&!8&(I!@)>%8!8GT O %H"&U&E&P@(%E!(X!(&4&!ž@)%(%SX&X&Xs&Xy@ _ %Xs!x!t&I!(&g!®@%H&P &PU!t&PD?%8@ W %PS!X!i&H&%!Hu®@%u!3LH/%(&H&H6&H"@ O %H5!8!&&!U¾@&@(%W&@!&@ %@G%@!!&8&!8@¶%!8%g&8&8&8@?%8!!&(t&`!(@a® %T!(%E&(&(&(@`/%(!`!&`S&`!`@¦%4X!`%&`>&`&`@ g %`!!3&&5!q¾@%wTH!3%&&"&'@%7!8!&&!^@%^!%XL(&&X&Xe@ _ %Xw!x!&&!@%H!%w&~&P&`L@ g %`!P!U&Pt&PR¾!@Q%PWL!P%J&P&HI,&1@%7!H8!4&#&HS&H6&@hV!0@I&X %H*@ _ !%XcH%<!Xx!s&X&Xu& @!Xk ž&8%s4&`%@ g %`&Y@!`!$&`&(E!s&`8&Ō@@!`L–%"%r!(%D!!6&!Č&3%C!@¶%v! DÌ ʌŒ!v!C!!֬ҬĬ Ԭuլ|''! $8,$ q! J<0'!@+$,(!@B$B%b.%(eC0%8B0!8%b&% Db0c0% % &(1&H<T$! f #0&! `%&P !0,( ! !(@$0''J<$ӌ0' 40,(!!#`!$#+ ( $!(@!  !0"!(A,`%$! $(P !0 &!?0($(v&!  !(!T#@."@B2@! 4&#(Ab. @!(E(!  @$! @$!0 P s& &!C> #$$! @!(`P !0 !S?244( 3&!0! t!(@ !@. @T0! `@$P !0 &(! ``%& !0040,($ 8'J<0'('!H4 !!@7 $' ! @4! ! 0#0$ !8`! @! `x @D !  $ @ ! 4P !0@w R! @! !(  !0@! @  !(D ! !' j%8f02%0c0%! P!( $ &4!@0,($ 8'p'!\t COGHI!̌ʌҌ|xpl ƌ b+E$e!'$b`\+ @!@ $'!d!h.%0*"%(e0%(B$K@"% %bB&"%8g&8GBK% !8$p %H# $L%N@&u%"&#% <& d6!pD! !P!x& !p@ $ D: %8 &  ! %bB~  &%xo&xO%B;!x$h%8 $K%M%m"&% V9<& d[7!hD!>!`!F&0E$0& !0D @ %8b!  B % !h&%T$ &bB; %!$%80 $h' %t% 2 & %0&0!fY<c4!!XK!!E&($(e&!(C @ %0b!  B % &%R$&bB3%!$%0($n'%r% *& %(&(!e!B!@H?< 4!0D!P&0l$0& !0D@"%8)&BV% & %j,&B;% T!$PT%80$ /% %(U2&(%0&0!P$<^4!PC!pn!!l&` $`& !`d"@%8)&B6% & %f&% R$0R$ % , B3 %08 / !%((<&(= 2 5%0!8!hm!X&8$8&0!0& !0!8d@ " %`) & B^ %  & %k&% $X$ % ,B[!%Xe8/%(&(e:],%8<&8[6!X!8!t!@&8$8!Xc&!8z@%x)BF%!&% & d%f$@f$j%h, BC ! %@8 / %(&(: E %80&81$!&(&%8&8g!p% !($f$8 %g$B;%8p'% & u:%84&8 U<}$! !P!h& T!8g$ D@ z & %xq  !8!hB. %! &% & d%$($k! %eBk,%(po%h&hu*%(&(!(e!(!08r%0)%(&08&0!0&!-%0)%(&08&0!0!tJ ) %(&08 &0!0F!\ %0 %g&08 &0!p!p>%0%g&08&0!0!h!h1<&Kmƥ4!($&k!@!(2@%@96%0&0BF%h&!%("$@"$(%(4 BC %@8 7 %0&0: E %8&8!@!@!v@3%0B,%(e4b4&0&(34%0@>%g&0 &0!0!`%(&(%g&%( $8 $(%(4B;!c%8X7%0f&0]:%8&8!8!8! d@3  %0B,  8%(eZ &0&(3@^%0%k4X&0&0!X!Xp!XeY<$!(e!P&(2@$(%&(6!PE%0B.&0%e&%0!(C$$0%0fBS%CW%P&Pj%u&C!!e!@ , %B4 + %0R <&&0<S,<%PE)@%(&PE¨8&PU!PE!PY!qP$B$8lptxd h(hd !ph0'  (lptx@h-!-@! t! p`$! !p! \$$'$$$75`-V:+ @&! &+0P&! &+0$! &@+ &! &+0&1! 0$&+ PB0 0!00$ĠB0&0B$$ `&+0P&!0Ǡ&!&+@]@+X ` &!Xe &+@r&!Xe@+X`!Xb&!B!C$C!$P! $!  ! (0!(%12 +`@V$$+ `@!@`+ &! '$&+(P&! $$&+($! '$&@+ P&! \$&@`P+ + `+! !+ &! '$&+(&! '$@+ !@H@P&!!QH& @H&D!$#V!P$$0PH `$ ! D@D$! !(J ! Q+R!(@+R !(D+0CPB$!0ĠB$# E! $DD+Rm@!T `$$!@ $$ ! !(@w !8U $H<$ $I$!D6!H! :$ D+)@$@!\$D$&! !@&+(L!!BB$B0 B,@P$+@$!0$$+(R$!0$: E!@!$E0$&!$0$E@T! ! HU G<$$ $ 5I$!$'J<0''@TPLHD@(d`\X!!! !!@BI<(0A I<*B(@I<<$B4#&+B@/P `V&! >8<4 (4(!@8<"Œ"d#0 ! $!( 0!262(,6& ! @!(!0w !8+V`(V$I J<0'! 0 ! ¿#ß!^+!s3!SD! !(`d$ !8%C0 @$@! !(`d$ !8B0D8, $ r $p @H<Ä$! $'B$!U+!d!C@!<Q*;$ Q!@ <.#&C b%bB$#P$@'d&G $!X#C+!dm$#08(p!!8! '+(f!(''%!#B$'! !b$+C! d0p!'!0H+(!d<$!08p!8g!+(F!!(0p! Q!+!Ph#!PJ#PY+ #Dd''!h!p!x!+'d'40 !(` $(0 ! 0!T%T% P%+ *X`U%#3$%3$!x!+X !h72!p.C,j@< <'6$X)%!p@h@%hM#8<#H+8'!#C!`!X$ $*($T!+ TB02!b$+ ! *x$T!+(B0!B0)@!+(L! d! '8'40 XD,0'%@!+ L!Xn!`@!!X!m+ G$! !8@&!2$ !8!@B,!1@`! ppE!@! !(@ X'!(9! :!!! !(( !0'!'!8WS$*@*'!9E$R$0*D@X!D!^D!^D'!R$DX\r9\:: 04#!* 08!8$!* Q!!~*Q@P@X#02\P! '*@*@!@ !^!D!IB!B$:!!T,`'!( &!@B,{@` ! !@PU'! !(@ X'!@b!(:! $AR$!+@P X\: @TL   @: $L @T!R( ! `:B$$L(! !( !0 !(!R$g&^$+ U{+ S!@0 !HF! ~!0$B$z:Ȭ!(! ( !0`L @ ! B&!~!S:$!S! R  ! !(^:B$* RbP!@B$ ! :$bR$0*D@X!D!^D@@P! D!RDL@0 !F^'!($dB&X\:!@ !|x''$$0J< 0'*r,(! b*2@,!C!QD@@!DD !qb:1& ($ 0'$r$!QDBB(@!(`! H4 ,@,! @H4 !(` @! H4 !(@! @H4 !(@'!0G !(!@@D  H! Gs&!'*"@!CS! H4 !(`@! @H4 !(`E$B ! @H1&D  !TPLHD@<840X'J<'0'$ !aH<0TP0 $$aH 0bB(@$!Q#$aH<N@ $L ! @$_$ " $bH$D!(E3 !( @$ $"!0M$ 0$ !(''!F $!E!$D!D,$$ DPH!D$ D&H!A!H3 @TH$&6! $T"C@c0 `!H$TT"Cc0%`!<c4$`$X&! &H !(@c0! @b0@b00!b0@ b00 ! b0@Pc00!c0`$B0$ ('p'!J<“0'$tl|xph!!!Lį $ï @( 0$(¯܏@ $H '!LÏHw.,'@ï,0@4&#'ID ! $܏!@@Dï(! @!(  !0"8'܏8¯1ITïF<$ $"TBB$!"ED#8$$$$qbD8,'8'! !0= !8 ܏!@8Ǐ"*G7@LÏ b$! DgET $B$* VP"!"$GC"|P`bTuHׯ!CE0Pï8dd!BB$H¯ $r,'!0f!(LC \Ư܏@\Ə׌$!*w@ Œ!DGHď!(Xï\ƯH4 `ǯ܏XÏ\Ə@`Ǐ$c$,'!(H4 !܏@!8l8ȏ&iC$ r! ! ܏Q@D 4ďDÏ`܏D ! @= ! {J $ET"B$*(V!("*0P! @I!( <$ dP!BB$DP! !(@(`ǯ !0܏GI`ǏVTu#&!V,'dB$d$ TB$V,'8'! !0= !8 !@JI܏Ic$D4ď !dJ܏(! @!(  !0 &E ,'@܏\J!0$(Ep`ǯ Xȯ܏`Ǐ@Xȏ@I!8c$hI!8ǏHŏ! !B !0`!8@4@܏9J$P,'b8ŏ舙!0`ǯ! D !(E܏#@`Ǐ$I$ Hď,'LC !(R@܏ $(r!bddW8!(!DH4 $%@܏PÏ8Ə! `gH !(@܏!8Hď !bW8D$! G8į\b*D@$db8!8G$$H4 !(@܏08Ǐ$I!4ď $܏DÏ`P!D ! @|J!D 4ďDÏ`܏D ! @= ! {J!@$I$!!|xtplh'' !!(X$&H !$!8$I0J0F0*!@ "!CTBc@!@hc0`h0h0P$ h0T$c0@Q$`$ U J$!$ (''<J<0'*LD8\XTPH@!!!@#PB(@d$!( $,204$8$ <K L@!`r R8 *"@Ly@!  !! !d!RC!B*("T!@* QD&*(T!d*Q!B! E&&H !0<*4*@)QV,(!U$V,H#0!( 0H!( #0#Q #Q !*C(`  !(U(! d!ecB$#u2K,L#S!Q04#S!Q8@XK$!cq$IKR&!bc dB$R&*T`TTVEL!B#Q@!$*F`d(!edgKB$%&&H !0<PB( @H(#0!( 0K@PH!( #0#Q #Q]L  @,L#S!Q04#S!Q8PC(`I `T $! '0L&#"!!B+D%& !(E$$+`T $dfP$0@!0F!#0($ !` 'B$@!c!h!Kh!(,(' '!Q!@#+@$. @$d&!($ #!($2BVNK ,,# '!(!0 !8C$c,` !T*@TL#@!S!TRL$$B! &&H !0<1LN @ $L ! @ @$_$B $B!M$ <@$!*F`(!ed5LB$KP@Pd $K!Q!CR@@ !RRD3 !(@@$ $B!M$ <K@T8!Q80#Q#qP0c(`8H@! M9 !@`P(L\8 LK`PH@P@: ! L@P(4 ! L((!\XTPLHD@<8`'$bT' CB ! $! ; !!@$d $ $ !&!0Čc0*<c$$%eì$ (''8(40!!! !(@HD@<TPL!!3 l!@B( @$"! 4 !(@"(!tgM(!V(b$D0$hC$8*G@whM$!$$$]$ $b^T(K@TL(d$(1M!C!@P((B !DBGP( ! D!b!DU$@T(! !(@ $3 (!B( $2M($!b(!DU(8*C2`P$V"!bchB$"!T&UhM$("$!TbC$C$CT!VM$VM$$gM" CT V h'd4 !($b $ b"!TPLHD@<840X'(8*`T$!J<'0'!G40,($ S$Abd!"LLd (!C! E $ '$D d8#@d 'LC !((@Ld8'!8!( 'R dddL!CB @8 !VŎLC ! @@UD@P D (U8@T >UD (U $Dc$-UDD (!A@< UD@! O !(@<b@@! !(@gS !0<0@ UD<8@Pd UD|xtplh'',X$<!84J! `!(!0!8@QF !!@¯D  L@L&fX!! !(t8 !0@b4@B0 @L! cL!(Pct'',(`d<840LHD@P!!!~_ !@@$A!$5d $!b$ V7P!- P!(@!0`~_ !8!@@@%E@!%$" $7C! !(sO !0`"$$ C$`` $ TT`! !(!0 !8d $$@TT@EE%(%+%F!D0 <E0$D$+!b!<$ d T!@'%!@`$ "%Xf8`$%XD k-%f(%Xf !X%f@ `$$ g"`!$%XDT$*(@T$*@ U$+j@T$CU+C+@P+0 $`$!!$$$ e<Ȝ'!<ec4'$e1/!H $!Q!<%bB%b%%d@P!` @hp p H$( ) @QC$( $%#PHCPD%CDd! $#` !P$% d $ P  ! $]<4k1$ !@ `? $!mQ%0<% BG% k%@%@Q!  Xp @p %(m) Q%( $h%#h h% @ !@ $#X !h$ $ h  @!@ $!X` %`%-&(f%d` k%!`l!X|`A!H!!<!Hh`!Hpx+8!H.!h0!8m+P.!@! +8+h+PJ%8+!8%C!%@: @%d% + M %H<@$ d%"D0B%'%DBw!X% <$ ]T$^$(%+%G!D0 <E0$D$+!b!<$ dT!@'%( @<$#p<#+(# #e3(@%(eh $3$#f b(@$8d$ %e# ! #+ ##d!! '<'!'%40,($ !a@!Ÿ`!#+##"!! !0   5r r &>$#U4D*P7D* *O@+*@+$�U0%0F&0pB! *l$! !(  #0! h!( 8&!@ !`%C+ %! *<(* P&& ($#ub%b!<4D0$eE0$D$+!b!<$ d€<4?$$d#U@'%0!0!!!<R2c4$%r4% s!0,($ !8'! $#F@\#! EE0% F!!  $#8\8#8!(%!!<'!'p0,($ 4!! !!tt!@# 0!BY! `!( !01&40,($ 8'<@'!!!0$ !(@<'!!d!0$ !(@<ജ'!!܅!0$ !(@'I< $&$1$ &hv ('!x u$!x t$!x s$!x r$!x q$!x p$!x o$!x n$!x m$!x l$!x k$!x j$!x i$!x h$!x g$!x f$!x e$!x d$!x c$!x b$!x `$!x _$!x ^$!x ]$!x \$!x Z$!x Y$!x X$!x W$!x V$!x U$!x T$!x S$!x R$!x Q$!x P$!x N$!x M$!x L$!x K$!x J$!x I$!x H$!x G$!x F$!x E$!x D$!x C$!x B$!x A$!x @$!x ?$!x >$!x =$!x <$!x ;$!x :$!x 9$!x 8$!x 7$!x 6$!x 5$!x 4$!x 3$!x 2$!x 1$!x 0$!x /$!x .$!x -$!x ,$!x +$!x *$!x )$!x ($!x '$!x &$!x %$!x $$!x #$!x !$!x  $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x  $!x  $!x  $!x  $!x  $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x ~$!x }$!x |$!x z$!x y$!x x$!x w$!x v$!x u$!x t$!x s$!x r$!x q$!x p$!x o$!x n$!x m$!x l$!x k$!x j$!x i$!x h$!x g$!x f$!x e$!x d$!x c$!x b$!x a$<У'!'J<0'$ 9'  'Too many fds open. Cannot use select on a fd >= %d Connecting to %s|%s|:%d... Connecting to %s:%d... Connecting to [%s]:%d... setsockopt SO_RCVBUF failed: %s %s: unable to resolve bind address %s; disabling bind. connected. failed: %s. %s: unable to resolve host address %s setsockopt SO_REUSEADDR failed: %s .Aorig.origCannot back up %s as %s: %s %d; URL=%s/index.html?#%;Converting links in %s... nothing to do. Cannot convert links in %s: %s Unable to delete %s: %s wb/:%d-%d Converted links in %d files in %s seconds. T@h@@t@0@domainpathexpiresmax-age%lfsecureSyntax error in Set-Cookie: %s at position %d. Cookie coming from %s attempted to set domain to Unable to get cookie for %s Cannot open cookies file %s: %s TRUEFALSE# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. %s %s %s %.0f %s %s Error writing to %s: %s Error closing %s: %s .com.edu.net.org.gov.mil.int?Length: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) ==> AUTH TLS ... done. Server does not support AUTH TLS. Falling back to FTP. Error in server response. Closing. []anonymous-wget@Could not initialize SSL. It will be disabled.Logging in as %s ... @Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> PBSZ 0 ... Server did not accept the 'PBSZ 0' command. done. ==> PROT %c ... Server did not accept the 'PROT %c' command. done. ==> SYST ... Server error, can't determine system type. done. ==> PWD ... ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. ==> CWD (%d) %s ... No such directory %s. ==> CWD not required. ==> SIZE %s ... File has already been retrieved. ==> PASV ... ==> EPSV ... ==> LPSV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s port %d: %s ==> PORT ... ==> EPRT ... ==> LPRT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %s ... REST failed, starting from scratch. ==> RETR %s ... No such file %s. ==> LIST ... No such file or directory %s. accept: %s ab%s has sprung into existence. Server does not want to resume the SSL session. Trying with a new one. Could not perform SSL handshake. Resuming SSL session in data connection. %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. byteData transfer aborted. 425FTPS server rejects new SSL sessions in the data connection. File %s exists. No such file %s. File %s already there; not retrieving. (try:%2d)--%s-- %s %s => %s Server does not support AUTH TLS. Server does not like implicit FTPS connections. %s URL: %s [%s] -> "%s" [%d] Removing %s. unlink: %s %s (%s) - written to stdout %s[%s] %s (%s) - %s saved [%s] .listingRemoved %s. Rejecting %s. ../Error matching %s against %s: %s No matches on pattern %s. %s/%sNot descending to %s as it is excluded/not-included. Remote file no newer than local file %s -- not retrieving. Remote file is newer than local file %s -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory %s. %s: unknown/unsupported file type. Failed to set permissions for %s. %s: corrupt time-stamp. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. A A A A A A A A A A A A A A AX A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A Aout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()-A4A4A-A4A-A-A-A.A .A.A.A$.A,.A4.A<.AD.AL.AT.A\.Ad.Al.At.At.At.At.At.At.A|.A|.A|.A.A.A.A.A.A.A.A.A.A.A.A.A/A.A "(54#A4+7U":57C45 F A:7 B:=( C+#BUK==K 88 Z FZ 8{DIOz969}66DO}96++}6P-I----------et1111111111QP<eeQ%%%s<<<<%%%%%%%%%%<`<V%%%%%%HV6Qa`6aa`kk%%%%%''''''''''aHlk''''''iH;Vt;aH{;{''''')));tx;txxxx{{))))))))))~~a))))))juj~juu`))))),,,,,,,,,,jju,,,,,,zzzzzzzB^Bjju\,,,,,??G4????????????????????????????????????????????????????????????????????????????GGGGGGGGGG30GGGGGGHHdddddGGGGGJJJJJdJ8 8dJJJJJJJJJJdJJJJJJdhhhhhxJJJJJJRRRRRR|h||||||hRRRRRRRRRRhyRRRRRRhxRRRRRRTTTTT:y:TTTTTTTTTTTTTTTTTTTTTTWWWWWW pWWWWWWWWWWWWWWWWfffffWWWWWW[  [[[[pff[[[[ [[[[ff[[[[[[[[]]]]]]]]]]]]]]]]MM"#]]]]]__________"#'______({l_lol/xoooo'_____(l&_l&s&/ossssolloXsok1sysXyyyyyyyjXsyygs1swwwwwbyYyYwwwwwwwwwwIsIswwwwwwaa_I_Iwwwwwwas_VSsel eR    ellqZZqrZr      !*!*!*zzz$$$$$>>>.d....%%%%%ccbAAAc     dd3333344444d bb 55555 b;;;;;`[[`m`[[`mf-----mm'66666YgfgF'gFFFFf--gfg<<<<<-YYY=====]]]]gkg]kkkkiGiGGGGGGGGGDDDDD\GG\\\\D\HHHHHHH\DD\JJJJJJJ77UUUUUutU!qoUU!*"0"0'2I*2IX?'J??EEEEEEEEEEJNOEEEEEEnhXrLLLLLNOEEEEEKKKKKMMMMMhNNNNNfKLKKKKaLOOOOOr_LLKLM[hKNMhMNZRhKNRRMQSOhWQNMhNOOPPPPP^////OSQQQQQORRRRRDVVVVVCWWWWWPPL^LTQP^Q^=VPPQj^RViTQR<^Q%R^9%W%VViWiRiVWiRSSSSSj8^W3`iWijjj71jF7c7n`Scnnnnfj;jSf;F;nSFS|S||S-S,nSnSTTTTTh)ThTTTT'vvvvvTv3&3vvmmvmTTuuuuuuuuuu]]]]uuuuuuvuuuuuwwwwww44ww{{{{{w{{{{eeee{w#####{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}$$$$$@}}}}}}}}}}}}}}}}@}}}}}@@(((((4444455555~oCB@?9720,+)@@66666  @:::::AAA      1H (1H(.....JJKKKKK>>>>>          .(      LLLLLU.>]Uj.]j          > > m  m PPPPPvrqpQQQQQnmig UUUUUEEEEEVVVVVcb^\YSEbbbbbcccccNM@EEdddddjjjjj>30.*&!kkkkklllllppppp|| \\\\\\\yyyyyyyy\vvvvvyyvvv{{{{{{}}}}}{{{{}}}~~~~~xxxxxxxxxxxxxxxx~xxxxx~~*****------5555555BBBBBBCCCCCC            ((((()))))*****             ...../////()*00000       .      ./.MMMMMTTTTT0TTTM                                                                                  1111199999199988888:::::88:iiiii_____8ii8:_i:_;;;;;<<<<<=====>>>>>?????DDDDDEEEEE;<=>?DDEFFFFFDGGGGGHHHHHIIIIIJJJJJNNNNNFOOOOO           G NHIJNNO !!!!!!!!!!!!WWWWWyyyyyWWWyyy!"""""""""""W""#############$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&+++++++++++++++++++++++++++222222222222222222222UUUUUUUUUUUUUXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYZZZZZZZZZZZZZ[[[[[[[[[[[[[\\\\\\\\\\\\$$$$$\]]]]]]]]]]]$]]^^^^^^^^^^^^^____________!!!!"""!""_``````````````````````!``````"``````aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaddddddddddddddddddddddddddddeeeeeeeeeeeeeeee%%%eeeeee%%%eeeeeellllllllllll)))%+++))++---+...--..lmmmmmmmmmmm)m+22222KKKK-22.K2LLLLLmnnnnnnnnnnnnIIIIIKIIILnoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooppppppppppppMMMMPPPMPPQQQRRRQQRRpqqqqqqqqqqqMqPQRqrrrrrrrrrrrrrssssssssssssstttttttttttttuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvzzzzzzzzzzzzz|||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~                                                                                                                                                                                                                         #############################&&&&&&&&&&&&&&&&&&&&&&&&&,,,,,,,,,,,,,,,,,,,,,,,,,,,,,/////////////////////////////5555555555555666666666666677777777777778888888888888888888888888888888888888888888888888888888888888888888888888888888889999999999999:::::::::::::;;;;;;;;;;;;;<<<<<<<<<<<<<=============>>>>>>>>>>>>>??????????????????????????????????AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEEFFFFFFFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[bbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeefffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~                                                $$*EO$`^ $_Ee$Okaf!^` E,l3e)G%kt)!"----------G%)ut(""/ghZG012222222222"Sg|3345637893:3;33<=>3333?33456789:3;33<=>3333AE3EB'HCiDbjecAdfBCiDb<H=ec$GG----------HJJJJJJJJJJE|JJJJJJ----------#%p$JJJJJ##Q$$Hq rsGGpRRRRRRRRRRqr(RRRRRRE$<%=()%RRRRRTTTTTTTTTTsTTTTTTjGm)nvoTTTTT((VmnWWWWWWWWWWghmiWWWWWWjP]$gicWWWWWJJJJJJJJJJqJJJJJJjq%]JJJJJvv]Uvvvvvvvvvvvvvvvwxxxyz{|xxvvvvxxxxxx}~vvvvvvvvvxxxxx}~vvvvvvvvvvv11ktUJl$kutIIIIE 1)1 sQ$GPP $s$p!"q#rsp%%SSSSq r  %35rI3*t+,E r5'UUtV.W$/012oVWGABC]E)xxxxx]mnvvvovvvvvmGnvvvvvvvv6789:FFFFF]]>?@^v]_h^hvvvvcSTUFFFF&ghe'(f]g eSTUFFFF) kt)ooopol#kut#F`$a]F`$4h4hf6cQ]]]]^]Q6QbcGdbccGFiKLMFNOPjaPQRNiiNQjRiKghgKMMEFFFGHIJFFHLFFFFFFZZZ[Z_HZLFFFFFXXXYX___`_FaaabaPF\]FFFF'\`QcccdceFaBlPf\C^Da'\\U`Qe_De\feeefe^ghk\tlUe\iD\ggghg9jegut \i%!k"&'\eeefe9lXkmmk\8nnooFl8mmkk]nniiijilF^V5]kggghg_]5vvvvvbx]^kyVz{\q0rbs+kkb,l-m\cnd0qorlllmlb|dmcnF..HFFFFIJdn]un)))*)-uuuuuuuuuu-uuuuuuIJuuuuu}}}}}}}}}}xxxx}}}}}}/+,0123(}}}}}xxxxooopo7;]8<9=])FM]]6N7OFWxxxxRST]qZZZ[ZWWWXWXXXYX]]]^]g___`_\aaabaY]aZ[I^mJ\bnom_\cndeo^fbQ\m] \cneghcccdc]\eeefegWWWXW]ggghgeeefe@Aggghg\isb(tkuj]c\d^_`a\ilibmkpknc\omlqnrmskopniiijipm qnrqKrLspcqr\qrs???@?\)qrlllml)h]A*vvvvvvxyzvA*{vpu                Q|/epfghi]          /z      ]]jjz qqqrq]]|xxxxc|   IIIIc\?\]]1}~x<wE;1PP$<w;23E4=>>>}~x)))*)=>%SSSS?xxxx:&:]?]55&&&&&&&&&&&&&&&&'&&&&&&&&&&&&&&&..(&UU$(xxxx ]BCKooopoBC)]xE]]]^]XXXYX]xExxxxyz{|xxxxxxxxxxxxZZZ[Zb___`_^cdxxxxx_baaaba^cG]cccdc\eeefe\ae(Gf]\\\egh\ik]\\jggghglg\ikv\lllmleeefeD(Dggghg]]mxxxxn];;]oxxxxx]mk niiiji4umlxn4k-o     H-]mIzn1H]v_P\q]r]sI]\???@?q]r1 G]j _]_     ]]GHz ]     ]]]]z ]]]]|  WWWXWWWWXW]]]|]Z']][ZX'NqqqrqMLK@.|_'     z      z      z|      |z ||zooopo |   IIIIPP$XXXYXPP%$)))*)^_]]]^]^%bcccdccdUUb$cijaaabai)___`_ZZZ[Zghgeeeefefaeggghgiiijilllmlkeeefelggghgkmnoqrsk%munlqrmknom&n???@?        z :|:WWWXWWWWXWqqqrqvvvvXXXYXZZZ[ZcccdclllmlO`]^tO_ia`^juti    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   )))*)zeeefe &&&&&&&&&&(&&&&&&k|&&&&&IIIIlkFFFFFFFFFF(FFFFFFaaabaWWWXWFFFFF&&&&&&&&&&(&&&&&&ooopoWWWXWgh&&&&&(((((((((((g((((((]]]^]___`_](((((((((((((((((((((bggghgcde(((((fbiiijiceeeefemnopggghgmnqrkspvvvvvvvvlqrkmnovvvvmnvvvv] QRiiiiijhk]   vvvvvxyz{ STTTTTSSSV |W]]]X Y ]qqqrq]( Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\ddddddddddddddddddddd]eeeeeeeeeeeeeeee???@?eeeeegiiiii(gggjm;niiiii_____jh;kklopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrxyyyyyxxx{|}]SSS]]]]]]]]]]])))*)     z ]???@?|WWWXWWWWXWqqqrq%]]]]&~    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   z |(((((((((SSS((((((]((((( Q   z Q   |    SSS       %'SSS(   & 2222231SSS4 STTTTTSSSV WX Y SSS [[[[    Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\SSS%giiiiigggjmnSSS%%om&22222314giiiiigggjnIIIII`caopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrgiiiiigggjmn)%%ogiiiiigggjmn&&ogiiiiigggjmnogiiiiigggjmnomgiiiiigggjnogqqqqgggjmno Y ~z |(((((((((((((((](((((STTTTTSSSVWXSTTTTTSSSVWX Y  [    [[[[       xyyyyyxxx{|}giqiiigggjmnogqqqqgggjmno   ~z |STTTTTSSSVWXSTTTTTSSSVWX[[[[    gqqqqlglllggjmllllnllllllllllllllllllllolllllllllllllllllllxyyyyyxxx{|}                        ~[[[[                                                                        !"!#####################$$*+,,,,,,,,,,,,,,,,,,,,,-.-/////////////////////02222200036789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;AAAAAAAAAAAAAAAAAAAAA~BBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDD[[[[           EEEEEEEEEE    EEEEEE                 EEEEE                   FFFFFFFFFFFFFFFFFFFFF                     LMLNNNNNNNNNNNNNNNNNNNNN!"!OOOOOOOOOOOOOOOOOOOOO$$*+,,,,,,,,,,,,,,,,,,,,,Q))RQ%SSSSSSSSSSSSSSSS&SSSSS-.-TTTTTTTTTTTTTTTTTTTTT022222000367860222220003V789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;022222000367802222200036780222220003678022222000367860222220003V780:::W:000367XXXXXXXXXXXXXXXX8XXXXXYYYYYYYYYYYYYYYYYYYYY~ZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[[[[[    gqqqqgggjmnoLMLbbbbbbbbbbbbbbbbbbbbb!"!cccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeexyyyyyxxx{6|}02:2220003678fffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~$$$$$$$$$$$$$$$$$$$$$555555555555555555555########&&&((((((((++FFFFIIIIIIIIPPPPPPPPPSSSSSSSSUUUUUUUUUYYYYYYYYY\\\wwwwwww~~~~~~~~~        ~~~~~~~~~#########(((((((((         wwwwwwUUUUUUUUUbbbbbbbbbggggggggglllllllllzzzzzzzzzSSSSSSSSS         UUUUUUUUUbbbbbbbbb         xxxxxxxxxggggggggglllllllll\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzzlllllllllwwwwww\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzz         wwwwww$$$$$$$$$)))))))))000000000555555555GGGGGGGGG        $$$$$$$$$)))))))))000000000555555555         lllllllll\\\\\\\\\^^^^^^^^^bbbbbbbbbGGGGGGGGGxxxxxxxxxzzzzzzzzziiiiiiiiitttttttttzzzzzzzzz{{{{{{{{{?_________wwwywJJRTWw____wJJREEEGEEKKKKKKKKETTKEEEuEuuxxxxxxxxxxxxxxxxxxxxxuu+++222++++++++++o               8 ,/ ?ACDNOST?A[NOST?NOST?NS? pCPUhT QpCpCL pCRpC pCpC pCpC} 3gpCQU {Wl f } pCH )G 9@AsNy&lF X F]TpCw\mpCpCZ Y F# ipPpCL z!  Hk  vk  P   W-Sm[  >'(9 HQL< k  h c d ,I j u l p) } D t E < \ [ e9 2 1 dM K K4<$,>\opC{;e@ ? H8 H =\(~(    k z  79   .c / xt  }   i  4aORy U   3UNjun 7 Fc t _ypC  pC I  4  c l+> oT G @H G 3      3 3N " <^ T1  e }  0     M # ( -    2  7 k &   = T Y b Y _ L QpC Y 1 m  /m$aA 0  {  ~ U C h ! \ D / O m ,  2  : N l G [\ '  5 ? TP ! < \ a s  sx q ^( Fx $R< cpCQpC}^ % _BV{=z t V~?+  Ko T}!|}_ Y  ` a +R<5 . 0UZV_dmT rJ#8F\sx[6-O, P' ($#SO3l\ 7B-2Ea ig>C F  Fbglq kw~pCq)b FPg Fq F j>03l/hQMpC  b F > w !:!s!!!"W"""#X##t# $I$ $$$m9 U02%k%%%L.&g&&&'K''''K(n (((&p <9)r)))5*n***+R+++ ,C,, ,C( -TE----3.u. ./G//\/|/b;0"w00$0+1d112D222#3 (Y1_3`x.} m334  *R44m l45?5x556;6t6667]7778888 F "879a99 9:':Q:{::  o::#;M;w;;; pC ;.>7>:>>>G>P>Y>b>k>n>w>>>>>>>>>>>>>>>>???!?*?3?(?@A,BCDEFG,HIJK,,L,MNO PQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ+)) )  )))%) ) )))   %$%########### (   ###!################  #####################!###"################################## ## (  ###########################!!######"##################################### ########################  '  ###################################!!!!######""######################################### #### '  #################################!!######""""#################################### #### &'  ##########################!!#####""############################ #### '''############!!##""####'''''###""'''''''&'&'''''&url(--> %s --> PASS Turtle Power! USER331 s/key 331 opiekey %d,%d,%d,%d,%d,%dPORT%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dLPRT|%d|%s|%d|EPRTAUTHTLSPBSZPROTPASVLPSVEPSVTYPECWDRESTRETRSYSTVMSUNIX215 UNIX Type: L8215 UNIX MultiNet Unix Emulation V5.3(93)WINDOWS_NTWINDOWS2000MACOSOS/400PWDSIZEtype=LIST -aLISTrbtotal -> ..MTotal of .DIR.DIR;1%d-%b-%Y %H:%M:%SWGET_TIMEZONE_DIFFERENTIALUnsupported listing type, trying Unix listing parser. (nil) ���Index of /%s on %s:%d���


  %d %s %02d %02d:%02d  time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
JanFebMarAprMayJunJulAugSepOctNovDec );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[m?index: %d al->faulty: %d Error in handling the address list. Please report this issue to bug-wget@gnu.org Resolving %s... failed: No IPv4/IPv6 addresses for host. , , ...%255s %d %d %lu %lua+# HSTS 1.0 Known Hosts database for GNU Wget. # Edit at your own risk. # %s %d %d %lu %lu Could not write the HSTS database correctly. Will not apply HSTS. The HSTS database must be a regular and non-world-writable file. AAȧA0A@ATAhAxA A AA%s: Cannot resolve incomplete link %s. http-equivrefreshcontentcontent-typerobotsnone , nofollowhrefrelstylesheetshortcut icontext/htmlactionsrcset , %s: Invalid URL %s: %s codesrcbackgroundlowsrcposterappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdvideoaudiosource0123456789abcdefHTTP/1.1 Failed writing HTTP request: %s. %s:%sBasic HTTP.%d%sNo headers, assuming HTTP/0.9%s%s authUnsupported quality of protection '%s'. MD5MD5-sessUnsupported algorithm '%s'. %08x00000001Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", qop=auth, nc=00000001, cnonce="%s"Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="%s", algorithm="%s"BasicDigestNTLMWWW-AuthenticateUnknown authentication scheme. Authentication selected: %s AuthorizationHEADGET?Proxy.zlib.Z.brDisabling SSL due to encountered errors. RefererCache-Controlno-cache, must-revalidatePragmano-cachegmtime failed. This is probably a bug. Cannot convert timestamp to http format. Falling back to time 0 as last modification time. Thu, 01 Jan 1970 00:00:00 GMT%s, %02d %s %04d %02d:%02d:%02d GMTIf-Modified-Sincebytes=%s-Wget/%s (%s)linux-gnuUser-AgentAccept*/*Accept-EncodinggzipidentityHostConnectionCloseKeep-AliveProxy-ConnectionContent-Typeapplication/x-www-form-urlencodedBODY data file %s missing: %s Content-Lengthpostputpatch0Proxy-AuthorizationReusing existing connection to [%s]:%d. Reusing existing connection to %s:%d. CONNECTFailed reading proxy response: %s %s ERROR %d: %s. Malformed status lineProxy tunneling failed: %sNo data received. Read error (%s) in headers. %2d %s Transfer-EncodingchunkedSet-CookieContent-Dispositionfilename%s.tmp(no description)Strict-Transport-SecurityincludeSubDomainsCould not parse String-Transport-Security header LocationLast-ModifiedX-Archive-Orig-last-modifiedContent-RangebytesContent-Encodingbrcompressdeflatex-compressx-gzipLocation: %s%s unspecified [following]application/xhtml+xmltext/cssFile %s not modified on server. Omitting download. .html.cssServer ignored If-Modified-Since header for file %s. You might want to add --no-if-modified-since option. The file is already fully retrieved; nothing to do. Length: ignored [%s] Saving to: %s STDOUT%s request sent, awaiting response... Warning: wildcards not supported in HTTP. File %s already there; not retrieving. Spider mode enabled. Check if remote file exists. --%s-- %s %s --%s-- %s Cannot write to %s (%s). Required attribute missing from Header received. Username/Password Authentication Failed. Cannot write to WARC file. Cannot write to temporary WARC file. Unable to establish SSL connection. Cannot unlink %s (%s). ERROR: Redirection (%d) without location. %s: Remote file does not exist -- broken link!!! Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file %s -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists. %s URL:%s [%s/%s] -> "%s" [%d] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s URL: %s %2d %s %s (%s) - %s saved [%s/%s] %s (%s) - written to stdout %s[%s/%s] %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %TrealmopaquenonceqopalgorithmSunMonTueWedThuFriSat[%s][%s]:%dCB7B7B8BCB9BBBBBBBBBBBBBBBBBBBBBBBBB7B7B7B7B7B7BBBBBBBBBBBBBBBBBCBDB:B7BBBCB7BBBCB8BBB7BCBCB09B9BBB\8BCB8B8B8B%s: %s must only be used once %s: %s: Invalid time period %s %s: %s: Invalid value %s. bitsunix%s: %s: Invalid restriction %s, use [unix|vms|windows],[lowercase|uppercase],[nocontrol],[ascii]. vmswindowslowercaseuppercasenocontrolasciiinfWGET_ASKPASSSSH_ASKPASSuse-askpass requires a string or either environment variable WGET_ASKPASS or SSH_ASKPASS to be set. %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid number %s. quiet%s: %s: Invalid %s; use `on', `off' or `quiet'. %s: %s: Invalid WARC header %s. %s: %s: Invalid header %s. %s: %s: Invalid byte value %s %s: %s: Invalid progress type %s. no_proxyHOMEWGETRC%s: WGETRC points to %s, which couldn't be accessed because of error: %s. %s/.wgetrc%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command %s in %s at line %d. SYSTEM_WGETRCParsing system wgetrc file (env SYSTEM_WGETRC) failed. Please check '%s', or specify a different file using --config. /usr/local/etc/wgetrcParsing system wgetrc file failed. Please check '%s', or specify a different file using --config. %s: Warning: Both system and user wgetrc point to %s. %s: Invalid --execute command %s pemasn1autoIPv4IPv6posixsslv2sslv3tlsv1tlsv1_1tlsv1_2pfsacceptacceptregexaddhostdiradjustextensionalwaysrestaskpasswordauthnochallengebackupconvertedbackupsbindaddressbodydatabodyfilecacertificatecadirectorycertificatecertificatetypecheckcertificatechooseconfigconnecttimeoutcontentdispositioncontentonerrorcontinueconvertfileonlyconvertlinkscrlfilecutdirsdebugdefaultpagedeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleegdfileexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpscleardataconnectionftpsfallbacktoftpftpsimplicitftpsresumesslftpuserglobhstshstsfilehtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsonlyhttpsproxyhttpuserifmodifiedsinceignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlyirikeepbadhashkeepsessioncookieslimitrateloadcookieslocalencodinglogfileloginmaxredirectmethodmirrornetrcnoclobbernoconfignoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppinnedpubkeypostdatapostfilepreferfamilypreservepermissionsprivatekeyprivatekeytypeprotocoldirectoriesproxypasswdproxypasswordproxyuserquotarandomfilerandomwaitreadtimeoutreclevelrecursiverefererregextyperejectrejectedlogrejectregexrelativeonlyremoteencodingremovelistingreportspeedrestrictfilenamesretrsymlinksretryconnrefusedretryonhttperrorsavecookiessaveheaderssecureprotocolserverresponseshowalldnsentriesshowprogressspanhostsspiderstartposstrictcommentstimestampingtrustservernamesunlinkuseaskpassuseproxyuseragentuseservertimestampsverbosewaitwaitretrywarccdxwarccdxdedupwarccompressionwarcdigestswarcfilewarcheaderwarckeeplogwarcmaxsizewarctempdirxattr$@N@ @u"A@0AA@pB @0123456789ABCDEF%s: %s: %s wget-log %s received. Redirecting output to %s. %s: %s; disabling logging. Usage: %s [OPTION]... [URL]... WTF?!SIGHUPSIGUSR1GNU Wget %s, a non-interactive network retriever. %s/.wget-hsts%dd %dh %dm %ds%ss %*c%s Wgetrc: Locale: Compile: Link: GNU Wget %s built on %s. %s (env) %s (user) %s (system) /usr/local/share/localeCopyright (C) %s Free Software Foundation, Inc. 2015License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Please send bug reports and questions to . Cannot create pipe Error initializing spawn file actions for use-askpass: %d Error setting spawn file actions for use-askpass: %d Error spawning %s: %d Error reading response from command "%s %s": %s wgetMemory allocation problem no-configconfigExiting due to error in %s Try `%s --help' for more options. %s: illegal option -- `-n%c' Debugging support not compiled in. Ignoring --debug flag. Both --no-clobber and --convert-links were specified, only --convert-links will be used. Both --no-clobber and --convert-file-only were specified, only --convert-file-only will be used. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k or --convert-file-only and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. File `%s' already there; not retrieving. WARC output does not work with --no-clobber, --no-clobber will be disabled. WARC output does not work with timestamping, timestamping will be disabled. WARC output does not work with --spider. WARC output does not work with --continue or --start-pos, they will be disabled. Digests are disabled; WARC deduplication will not find duplicate records. dotCompression does not work with --continue or --start-pos, they will be disabled. Cannot specify both --ask-password and --password. Specifying both --start-pos and --continue is not recommended; --continue will be disabled. %s: missing URL You cannot specify both --post-data and --post-file. You cannot use --post-data or --post-file along with --method. --method expects data through --body-data and --body-file options You must specify a method through --method=HTTPMethod to use with --body-data or --body-file. You cannot specify both --body-data and --body-file. POSTbody-databody-fileThis version does not have support for IRIs Password for user %s: Password: -k or -r can be used together with -O only if outputting to a regular file. --convert-links or --convert-file-only can be used together only if outputting to a regular file. ERROR: could not open HSTS store at '%s'. HSTS will be disabled. ERROR: could not open HSTS store. HSTS will be disabled. Username for '%s%s': Password for '%s%s@%s': No URLs found in %s. FINISHED --%s-- Total wall clock time: %s Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit -h, --help print this help -b, --background go to background after startup -e, --execute=COMMAND execute a `.wgetrc'-style command Logging and input file: -o, --output-file=FILE log messages to FILE -a, --append-output=FILE append messages to FILE -q, --quiet quiet (no output) -v, --verbose be verbose (this is the default) -nv, --no-verbose turn off verboseness, without being quiet --report-speed=TYPE output bandwidth as TYPE. TYPE can be bits -i, --input-file=FILE download URLs found in local or external FILE -F, --force-html treat input file as HTML -B, --base=URL resolves HTML input-file links (-i -F) relative to URL --config=FILE specify config file to use --no-config do not read any config file --rejected-log=FILE log reasons for URL rejection to FILE Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits) --retry-connrefused retry even if connection is refused -O, --output-document=FILE write documents to FILE -nc, --no-clobber skip downloads that would download to existing files (overwriting them) --no-netrc don't try to obtain credentials from .netrc -c, --continue resume getting a partially-downloaded file --start-pos=OFFSET start downloading from zero-based position OFFSET --progress=TYPE select progress gauge type --show-progress display the progress bar in any verbosity mode -N, --timestamping don't re-retrieve files unless newer than local --no-if-modified-since don't use conditional if-modified-since get requests in timestamping mode --no-use-server-timestamps don't set the local file's timestamp by the one on the server -S, --server-response print server response --spider don't download anything -T, --timeout=SECONDS set all timeout values to SECONDS --dns-timeout=SECS set the DNS lookup timeout to SECS --connect-timeout=SECS set the connect timeout to SECS --read-timeout=SECS set the read timeout to SECS -w, --wait=SECONDS wait SECONDS between retrievals --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals --no-proxy explicitly turn off proxy -Q, --quota=NUMBER set retrieval quota to NUMBER --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host --limit-rate=RATE limit download rate to RATE --no-dns-cache disable caching DNS lookups --restrict-file-names=OS restrict chars in file names to ones OS allows --ignore-case ignore case when matching files/directories -4, --inet4-only connect only to IPv4 addresses -6, --inet6-only connect only to IPv6 addresses --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none --user=USER set both ftp and http user to USER --password=PASS set both ftp and http password to PASS --ask-password prompt for passwords --use-askpass=COMMAND specify credential handler for requesting username and password. If no COMMAND is specified the WGET_ASKPASS or the SSH_ASKPASS environment variable is used. --no-iri turn off IRI support --local-encoding=ENC use ENC as the local encoding for IRIs --remote-encoding=ENC use ENC as the default remote encoding --unlink remove file before clobber --no-xattr turn off storage of metadata in extended file attributes Directories: -nd, --no-directories don't create directories -x, --force-directories force creation of directories -nH, --no-host-directories don't create host directories --protocol-directories use protocol name in directories -P, --directory-prefix=PREFIX save files to PREFIX/.. --cut-dirs=NUMBER ignore NUMBER remote directory components HTTP options: --http-user=USER set http user to USER --http-password=PASS set http password to PASS --no-cache disallow server-cached data --default-page=NAME change the default page name (normally this is 'index.html'.) -E, --adjust-extension save HTML/CSS documents with proper extensions --ignore-length ignore 'Content-Length' header field --header=STRING insert STRING among the headers --compression=TYPE choose compression, one of auto, gzip and none --max-redirect maximum redirections allowed per page --proxy-user=USER set USER as proxy username --proxy-password=PASS set PASS as proxy password --referer=URL include 'Referer: URL' header in HTTP request --save-headers save the HTTP headers to file -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION --no-http-keep-alive disable HTTP keep-alive (persistent connections) --no-cookies don't use cookies --load-cookies=FILE load cookies from FILE before session --save-cookies=FILE save cookies to FILE after session --keep-session-cookies load and save session (non-permanent) cookies --post-data=STRING use the POST method; send STRING as the data --post-file=FILE use the POST method; send contents of FILE --method=HTTPMethod use method "HTTPMethod" in the request --body-data=STRING send STRING as data. --method MUST be set --body-file=FILE send contents of FILE. --method MUST be set --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL) --content-on-error output the received content on server errors --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge HTTPS (SSL/TLS) options: --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, TLSv1, TLSv1_1, TLSv1_2 and PFS --https-only only follow secure HTTPS links --no-check-certificate don't validate the server's certificate --certificate=FILE client certificate file --certificate-type=TYPE client certificate type, PEM or DER --private-key=FILE private key file --private-key-type=TYPE private key type, PEM or DER --ca-certificate=FILE file with the bundle of CAs --ca-directory=DIR directory where hash list of CAs is stored --crl-file=FILE file with bundle of CRLs --pinnedpubkey=FILE/HASHES Public key (PEM/DER) file, or any number of base64 encoded sha256 hashes preceded by 'sha256//' and separated by ';', to verify peer against --random-file=FILE file with random data for seeding the SSL PRNG --egd-file=FILE file naming the EGD socket with random data HSTS options: --no-hsts disable HSTS --hsts-file path of HSTS database (will override default) FTP options: --ftp-user=USER set ftp user to USER --ftp-password=PASS set ftp password to PASS --no-remove-listing don't remove '.listing' files --no-glob turn off FTP file name globbing --no-passive-ftp disable the "passive" transfer mode --preserve-permissions preserve remote file permissions --retr-symlinks when recursing, get linked-to files (not dir) FTPS options: --ftps-implicit use implicit FTPS (default port is 990) --ftps-resume-ssl resume the SSL/TLS session started in the control connection when opening a data connection --ftps-clear-data-connection cipher the control channel only; all the data will be in plaintext --ftps-fallback-to-ftp fall back to FTP if FTPS is not supported in the target server WARC options: --warc-file=FILENAME save request/response data to a .warc.gz file --warc-header=STRING insert STRING into the warcinfo record --warc-max-size=NUMBER set maximum size of WARC files to NUMBER --warc-cdx write CDX index files --warc-dedup=FILENAME do not store records listed in this CDX file --no-warc-compression do not compress WARC files with GZIP --no-warc-digests do not calculate SHA1 digests --no-warc-keep-log do not store the log file in a WARC record --warc-tempdir=DIRECTORY location for temporary files created by the WARC writer Recursive download: -r, --recursive specify recursive download -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite) --delete-after delete files locally after downloading them -k, --convert-links make links in downloaded HTML or CSS point to local files --convert-file-only convert the file part of the URLs only (usually known as the basename) --backups=N before writing file X, rotate up to N backup files -K, --backup-converted before converting file X, back up as X.orig -m, --mirror shortcut for -N -r -l inf --no-remove-listing -p, --page-requisites get all images, etc. needed to display HTML page --strict-comments turn on strict (SGML) handling of HTML comments Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions -R, --reject=LIST comma-separated list of rejected extensions --accept-regex=REGEX regex matching accepted URLs --reject-regex=REGEX regex matching rejected URLs --regex-type=TYPE regex type (posix) -D, --domains=LIST comma-separated list of accepted domains --exclude-domains=LIST comma-separated list of rejected domains --follow-ftp follow FTP links from HTML documents --follow-tags=LIST comma-separated list of followed HTML tags --ignore-tags=LIST comma-separated list of ignored HTML tags -H, --span-hosts go to foreign hosts when recursive -L, --relative follow relative links only -I, --include-directories=LIST list of allowed directories --trust-server-names use the name specified by the redirection URL's last component -X, --exclude-directories=LIST list of excluded directories -np, --no-parent don't ascend to the parent directory Mail bug reports and suggestions to accept-regexadjust-extensionappend-outputask-passwordauth-no-challengebackup-convertedbind-addressca-certificateca-directorycertificate-typecheck-certificateclobberconnect-timeoutconvert-file-onlyconvert-linkscontent-dispositioncontent-on-errorcrl-filecut-dirsdefault-pagedelete-afterdirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userftps-clear-data-connectionftps-fallback-to-ftpftps-implicitftps-resume-sslhelphost-directorieshsts-filehtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userhttps-onlyignore-caseignore-lengthignore-tagsinclude-directoriesinet4-onlyinet6-onlyinput-filekeep-badhashkeep-session-cookieslevellimit-rateload-cookieslocal-encodingrejected-logmax-redirectnono-clobberno-parentoutput-documentoutput-filepage-requisitesparentpassive-ftppost-datapost-fileprefer-familypreserve-permissionsprivate-keyprivate-key-typeshow-progressprotocol-directoriesproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandom-waitread-timeoutregex-typereject-regexrelativeremote-encodingremove-listingreport-speedrestrict-file-namesretr-symlinksretry-connrefusedretry-on-http-errorsave-cookiessave-headerssecure-protocolserver-responsespan-hostsstart-posstrict-commentsif-modified-sincetrust-server-namesuse-askpassuse-server-timestampsuser-agentversionwarc-cdxwarc-compressionwarc-dedupwarc-digestswarc-filewarc-headerwarc-keep-logwarc-max-sizewarc-tempdir,o@Ho@o@o@q@q@p@ p@q@?forceportaccount.netrcdefaultmacdefmachine%s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name BxB(BBĘBB B%dm%s%ds%dh%s%dm%dd%s%dh%dd%3d%% %4.*f%s --.-KB/s in binarymegagigaInvalid dot style specification %s; leaving unchanged. %4.*f%c=%s=%ss %6sK %*s[ skipping %sK ],barnoscroll b/sKb/sMb/sGb/s B/sKB/sMB/sGB/s KMG eta %s333333?@Y@X@= ףp#@@Gz?A?Cannot get REALTIME clock frequency: %s MbP?eASCHEME_HTTPSCHEME_HTTPSSCHEME_FTPSSCHEME_FTPSCHEME_INVALID%s %s %s %i %s %s %s %sSUCCESSBLACKLISTNOTHTTPSNONHTTPABSOLUTEDOMAINPARENTREGEXRULESSPANNEDHOSTROBOTSUNKNOWN%s REASON U_URL U_SCHEME U_HOST U_PORT U_PATH U_PARAMS U_QUERY U_FRAGMENT P_URL P_SCHEME P_HOST P_PORT P_PATH P_PARAMS P_QUERY P_FRAGMENT Removing %s since it should be rejected. BB BB$B0B sha1:WARC-Block-DigestWARC-Payload-Digest%Y-%m-%dT%H:%M:%SZWARC-Datewb+warc.gzwarcclassicoff%s-meta.%s%s-%05d.%s%s.%sOpening WARC file %s. Error opening WARC file %s. WARC-Typewarcinfoapplication/warc-fieldsWARC-Record-IDWARC-Filenamesoftware: Wget/%s (%s) format: WARC File Format 1.0 conformsTo: http://bibnum.bnf.fr/WARC/WARC_ISO_28500_version1_latestdraft.pdf robots: %s wget-arguments: %s Error writing warcinfo record to WARC file. wb9Error opening GZIP stream to WARC file. WARC/1.0 application/octet-streamWARC-Warcinfo-IDWARC-Concurrent-To CDXCDX file does not list original urls. (Missing column 'a'.) CDX file does not list checksums. (Missing column 'k'.) CDX file does not list record ids. (Missing column 'u'.) Could not read CDX file %s for deduplication. Could not open temporary WARC manifest file. Could not open temporary WARC log file. Could not open WARC file. Could not open CDX file for output. Loaded %d record from CDX. Loaded %d records from CDX. requestapplication/http;msgtype=requestrevisitWARC-Refers-ToWARC-Profilehttp://netpreserve.org/warc/1.0/revisit/identical-payload-digestWARC-Truncatedlengthapplication/http;msgtype=responseresponse%s %s %s %s %d %s %s - %s %s %s Found exact match in CDX file. Saving revisit record to WARC. resourcemetadatametadata://gnu.org/software/wget/warc/MANIFEST.txttext/plainCould not open temporary WARC file. metadata://gnu.org/software/wget/warc/wget_arguments.txtmetadata://gnu.org/software/wget/warc/wget.loguser.xdg.origin.urluser.xdg.referrer.url%s: %s: Failed to allocate enough memory; memory exhausted. aprintf%H:%M:%S%Y-%m-%d %H:%M:%Sutime(%s): %s Failed to unlink symlink %s: %s Failed to Fopen file %s Failed to get FD for file %s Failed to stat file %s, (check permissions) File %s changed since the last check. Security check failed.Failed to open file %s, reason :%s Failed to stat file %s, error: %s Trying to open file %s but it changed since last check. Security check failed.*?[]htmlhtm%.*f%cforkContinuing in background, pid %d. Output will be written to %s. /dev/nullInvalid regular expression %s, %s Error while matching %s: %d %.0f%.1f%.1g%.3fpathconf%02xsha256//;sha256//Skipping key with wrong size (%d/%d): %s -----BEGIN PUBLIC KEY----- -----END PUBLIC KEY----->?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/KMGTPEP?Afffff#@Mb@?        -cares+digest-gpgme+https+ipv6-iri+large-file-metalink+nls+ntlm+opie-psl+ssl/opensslmipsel-oe-linux-gcc --sysroot=/mnt/new2/softFPU/openpli/build/tmp/sysroots/et4x00 -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -msoft-float -march=mips32 -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib/ -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -msoft-float -march=mips32 -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib/ -DHAVE_LIBSSL -DNDEBUG -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -msoft-float -march=mips32 -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib/ -lssl -lcrypto -lz ftp-opie.o openssl.o http-ntlm.o ../lib/libgnu.a mipsel-oe-linux-gcc --sysroot=/mnt/new2/softFPU/openpli/build/tmp/sysroots/et4x00 -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -msoft-float -march=mips32 -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib/ -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -mel -mabi=32 -msoft-float -march=mips32 -Wl,--gc-sections -L/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib/ -DHAVE_CONFIG_H -DSYSTEM_WGETRC="/usr/local/etc/wgetrc" -DLOCALEDIR="/usr/local/share/locale" -I. -I../lib -I../lib -DHAVE_LIBSSL -DNDEBUG -mel -mabi=32 -msoft-float -march=mips32 -fdata-sections -ffunction-sections -Os -Wl,-rpath=/mnt/new2/sysroots/mipsel_softfpu_1.0.2/lib -I/mnt/new2/sysroots/mipsel_softfpu_1.0.2/include/ -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -D_LARGEFILE64_SOURCE -D_LARGEFILE_SOURCE 1.19.2OpenSSL: %s Could not seed PRNG; consider using --random-file. OpenSSL: unimplemented 'secure-protocol' option value %d HIGH:MEDIUM:!RC4:!SRP:!PSK:!RSA:!aNULL@STRENGTHWARNING: Could not save SSL session data for socket %d ERRORWARNING%s: No certificate presented by %s. %s: cannot verify %s's certificate, issued by %s: Unable to locally verify the issuer's authority. Self-signed certificate encountered. Issued certificate not yet valid. Issued certificate has expired. %s %s: no certificate subject alternative name matches requested host name %s. %s: certificate common name %s doesn't match requested host name %s. %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). openssl.cThe public key does not match pinned public key! To connect to %s insecurely, use `--no-check-certificate'. CCCCCCCCCCCCCCCCCCCNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sNTLM NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cCCCCCKGS!@#$%ABCDEFGHIJKLMNOPQRSTUVWXYZ234567 ’'e‘GB18030`literalshellshell-alwaysshell-escapeshell-escape-alwaysc-maybeescapelocaleclocalerDDdsD DTsDrD0DsDrDrDrD/tmpTMPDIR/%.*sXXXXXXmemory exhaustedPOSIXLY_CORRECT%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '%s' is ambiguous %s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument /dev/ttyw+;Zx0Nm<[y1OnDDDDDDDDDDDDDDDalphaupperloweralnumcntrlspacedigitprintblankgraphpunctxdigit_pEpEPpEpEqE~E4E4EEąE4E4E<EE4E`EԃE4E4E4E4E4E`E`EDE4E4EPEE4E4E4E4E4E4E4EEE,E,EdE@ETEEEEA>AHAIAWAC>CPEqA5Ad+AA(ACh@DHCH@CECiCA{A|qC8AC̤A$}Ct~CpEXBjC}CxbCB@C EGxDpEB(BC EEȁB(?C(A|uCuCB BlB\BB4B@CCX?C,A@B4BLBBCDBXB`C4Ap1B"A@l@x@ت@C CAB sCCpCAhD@D+Dh*DC|DCLB|-D@DPEXEEELlDD@(@p@D DCLC